BLASTX nr result
ID: Scutellaria23_contig00034331
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00034331 (342 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002305559.1| predicted protein [Populus trichocarpa] gi|2... 137 9e-31 ref|XP_002313669.1| predicted protein [Populus trichocarpa] gi|2... 132 4e-29 ref|XP_002265575.1| PREDICTED: uncharacterized protein LOC100250... 130 1e-28 ref|XP_002533502.1| conserved hypothetical protein [Ricinus comm... 130 1e-28 ref|XP_002527250.1| conserved hypothetical protein [Ricinus comm... 129 2e-28 >ref|XP_002305559.1| predicted protein [Populus trichocarpa] gi|222848523|gb|EEE86070.1| predicted protein [Populus trichocarpa] Length = 289 Score = 137 bits (345), Expect = 9e-31 Identities = 70/112 (62%), Positives = 81/112 (72%), Gaps = 4/112 (3%) Frame = +3 Query: 3 AGSYEFIDVVRPGFSF----RYLIDLDFASEFEIARPTKSYELLLQHLPRVFVGTSEDLK 170 AGSYEFIDVV S RY++DLDFAS+FEIARPT Y LL HLPRVFVG SEDLK Sbjct: 152 AGSYEFIDVVVQSKSSALQNRYVVDLDFASQFEIARPTSQYLKLLHHLPRVFVGKSEDLK 211 Query: 171 QILKDLSAAARRSLKSGGLYVPPWRKTRFMHNKWLGPYRRTTNIFPASFSSP 326 I++ +S AA+RSLKS L +PPWRK R+M NKW GPY RT N P + +P Sbjct: 212 TIVRSISDAAKRSLKSRELSLPPWRKNRYMQNKWFGPYLRTVNPLPTNSFTP 263 >ref|XP_002313669.1| predicted protein [Populus trichocarpa] gi|222850077|gb|EEE87624.1| predicted protein [Populus trichocarpa] Length = 289 Score = 132 bits (331), Expect = 4e-29 Identities = 67/107 (62%), Positives = 79/107 (73%), Gaps = 3/107 (2%) Frame = +3 Query: 3 AGSYEFIDVVRPGFSF---RYLIDLDFASEFEIARPTKSYELLLQHLPRVFVGTSEDLKQ 173 AG YEFIDVV+ S RY++DLDFAS+FEIARPT + L LPRVFVG SEDLK Sbjct: 156 AGGYEFIDVVQSKSSTLQNRYVVDLDFASQFEIARPTSQFLKLQHSLPRVFVGRSEDLKT 215 Query: 174 ILKDLSAAARRSLKSGGLYVPPWRKTRFMHNKWLGPYRRTTNIFPAS 314 I+K +S A++RSLKS L +PPWRK R+M NKW GPYRRT N PA+ Sbjct: 216 IVKSISDASKRSLKSRELSLPPWRKNRYMQNKWFGPYRRTVNPSPAT 262 >ref|XP_002265575.1| PREDICTED: uncharacterized protein LOC100250319 [Vitis vinifera] gi|296090565|emb|CBI40915.3| unnamed protein product [Vitis vinifera] Length = 282 Score = 130 bits (327), Expect = 1e-28 Identities = 64/102 (62%), Positives = 78/102 (76%) Frame = +3 Query: 3 AGSYEFIDVVRPGFSFRYLIDLDFASEFEIARPTKSYELLLQHLPRVFVGTSEDLKQILK 182 AG++EFIDV+R RY++DLDFA EFEIARPT Y+ L+Q LPRVF+G SEDLK+I+K Sbjct: 152 AGNHEFIDVLRS--EKRYIVDLDFAGEFEIARPTDQYKRLIQTLPRVFIGKSEDLKKIVK 209 Query: 183 DLSAAARRSLKSGGLYVPPWRKTRFMHNKWLGPYRRTTNIFP 308 AA+RSLKS GL++PPWRK R+M NKW GP RRT P Sbjct: 210 LTCDAAKRSLKSRGLHLPPWRKNRYMQNKWFGPCRRTATPSP 251 >ref|XP_002533502.1| conserved hypothetical protein [Ricinus communis] gi|223526646|gb|EEF28889.1| conserved hypothetical protein [Ricinus communis] Length = 285 Score = 130 bits (327), Expect = 1e-28 Identities = 65/99 (65%), Positives = 77/99 (77%) Frame = +3 Query: 3 AGSYEFIDVVRPGFSFRYLIDLDFASEFEIARPTKSYELLLQHLPRVFVGTSEDLKQILK 182 AG+YEFID V S RY+IDLDFAS+FEIARPT Y +Q LPRVFVG SE+LK+I+K Sbjct: 152 AGNYEFIDAVV--LSNRYIIDLDFASQFEIARPTNEYRKQVQSLPRVFVGKSENLKRIIK 209 Query: 183 DLSAAARRSLKSGGLYVPPWRKTRFMHNKWLGPYRRTTN 299 +S AA+RSLK+ L +PPWRK R+M NKWLGPY RT N Sbjct: 210 VMSDAAKRSLKTRDLSLPPWRKNRYMQNKWLGPYHRTCN 248 >ref|XP_002527250.1| conserved hypothetical protein [Ricinus communis] gi|223533343|gb|EEF35094.1| conserved hypothetical protein [Ricinus communis] Length = 286 Score = 129 bits (325), Expect = 2e-28 Identities = 66/99 (66%), Positives = 78/99 (78%) Frame = +3 Query: 3 AGSYEFIDVVRPGFSFRYLIDLDFASEFEIARPTKSYELLLQHLPRVFVGTSEDLKQILK 182 AG+YEFID V S RY+IDLDFAS+FEIARPTK Y +Q LP VFVG +EDLK+I+K Sbjct: 152 AGNYEFIDAVV--LSNRYIIDLDFASQFEIARPTKEYWKQVQSLPIVFVGKNEDLKRIIK 209 Query: 183 DLSAAARRSLKSGGLYVPPWRKTRFMHNKWLGPYRRTTN 299 +S AA+RSLKS L +PPWRK R+M NKWLGPY RT+N Sbjct: 210 VMSDAAKRSLKSRDLSLPPWRKNRYMQNKWLGPYCRTSN 248