BLASTX nr result
ID: Scutellaria23_contig00034255
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00034255 (324 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276084.1| PREDICTED: copper transporter 6 [Vitis vinif... 63 2e-08 ref|XP_002534182.1| copper transporter, putative [Ricinus commun... 61 8e-08 ref|XP_003551522.1| PREDICTED: copper transporter 1-like [Glycin... 61 1e-07 ref|XP_003530241.1| PREDICTED: copper transporter 6-like [Glycin... 61 1e-07 ref|XP_002313412.1| copper transporter [Populus trichocarpa] gi|... 61 1e-07 >ref|XP_002276084.1| PREDICTED: copper transporter 6 [Vitis vinifera] gi|321496072|gb|ADW93913.1| copper transporter [Vitis vinifera] Length = 152 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/40 (67%), Positives = 37/40 (92%) Frame = +3 Query: 3 RAGFSYLVMLAVMSYNGGVFIAAVLGHAIGYVIFGSGLRK 122 R+GFSY++MLAVMS+NGG+F+AAV GHA+G++IFGS + K Sbjct: 96 RSGFSYMLMLAVMSFNGGIFLAAVAGHALGFLIFGSRVFK 135 >ref|XP_002534182.1| copper transporter, putative [Ricinus communis] gi|223525742|gb|EEF28206.1| copper transporter, putative [Ricinus communis] Length = 163 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/47 (59%), Positives = 39/47 (82%), Gaps = 1/47 (2%) Frame = +3 Query: 3 RAGFSYLVMLAVMSYNGGVFIAAVLGHAIGYVIFGSGL-RKNEDRPN 140 R G SY+VMLAVMS+NGG+F+AAV GHA+G+ +FGS + K+E +P+ Sbjct: 109 RTGLSYMVMLAVMSFNGGIFLAAVGGHAVGFSLFGSKVFNKSEKKPD 155 >ref|XP_003551522.1| PREDICTED: copper transporter 1-like [Glycine max] Length = 150 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/44 (61%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +3 Query: 3 RAGFSYLVMLAVMSYNGGVFIAAVLGHAIGYVIFGS-GLRKNED 131 R+G SY+VMLAVMS+NGGVF+ A+ GH IG++IFG+ +RK D Sbjct: 100 RSGLSYMVMLAVMSFNGGVFVVAICGHVIGFLIFGTRAIRKKSD 143 >ref|XP_003530241.1| PREDICTED: copper transporter 6-like [Glycine max] Length = 189 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/44 (61%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = +3 Query: 3 RAGFSYLVMLAVMSYNGGVFIAAVLGHAIGYVIFGS-GLRKNED 131 R+G SY+VMLAVMS+NGGVF+ A+ GH IG++IFG+ +RK D Sbjct: 89 RSGLSYMVMLAVMSFNGGVFVVAICGHVIGFLIFGTRAMRKKSD 132 >ref|XP_002313412.1| copper transporter [Populus trichocarpa] gi|222849820|gb|EEE87367.1| copper transporter [Populus trichocarpa] Length = 155 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = +3 Query: 3 RAGFSYLVMLAVMSYNGGVFIAAVLGHAIGYVIFGSGLRKNEDRP 137 R G +Y+VMLAVMS+NGGVFI AV GH +G+ IFGS + K+ + P Sbjct: 98 RVGLAYMVMLAVMSFNGGVFIVAVAGHLVGFFIFGSRVFKDTEMP 142