BLASTX nr result
ID: Scutellaria23_contig00034087
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00034087 (349 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002878332.1| hypothetical protein ARALYDRAFT_907560 [Arab... 67 1e-09 ref|NP_191597.1| uncharacterized protein [Arabidopsis thaliana] ... 67 1e-09 ref|XP_003608671.1| Glycoprotein-like protein [Medicago truncatu... 66 3e-09 ref|XP_002511605.1| hypothetical protein RCOM_1608690 [Ricinus c... 65 6e-09 gb|ADN34231.1| hypothetical protein [Cucumis melo subsp. melo] 64 1e-08 >ref|XP_002878332.1| hypothetical protein ARALYDRAFT_907560 [Arabidopsis lyrata subsp. lyrata] gi|297324170|gb|EFH54591.1| hypothetical protein ARALYDRAFT_907560 [Arabidopsis lyrata subsp. lyrata] Length = 741 Score = 67.4 bits (163), Expect = 1e-09 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = -3 Query: 113 FPSQAPDFITQSVLTEFWEIIHLLFIGIAVSYGLFGR 3 FPSQAPDF+ ++VLT+FWE+IHLLF+GIAV+YGLF R Sbjct: 50 FPSQAPDFVGETVLTKFWELIHLLFVGIAVAYGLFSR 86 >ref|NP_191597.1| uncharacterized protein [Arabidopsis thaliana] gi|7287986|emb|CAB81824.1| putative protein [Arabidopsis thaliana] gi|332646532|gb|AEE80053.1| uncharacterized protein [Arabidopsis thaliana] Length = 743 Score = 67.4 bits (163), Expect = 1e-09 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = -3 Query: 113 FPSQAPDFITQSVLTEFWEIIHLLFIGIAVSYGLFGR 3 FPSQAPDF+ ++VLT+FWE+IHLLF+GIAV+YGLF R Sbjct: 49 FPSQAPDFVGETVLTKFWELIHLLFVGIAVAYGLFSR 85 >ref|XP_003608671.1| Glycoprotein-like protein [Medicago truncatula] gi|355509726|gb|AES90868.1| Glycoprotein-like protein [Medicago truncatula] Length = 483 Score = 65.9 bits (159), Expect = 3e-09 Identities = 32/64 (50%), Positives = 41/64 (64%) Frame = -3 Query: 194 QQIPSKSHSNAXXXXXXXXXXXXXXXLFPSQAPDFITQSVLTEFWEIIHLLFIGIAVSYG 15 QQ P+K H N L PSQAP+FI+Q++LT WE++HLLF+GIA+SYG Sbjct: 24 QQEPNKFHYNFAYKATIVLIFFVILPLLPSQAPEFISQNLLTRNWELLHLLFVGIAISYG 83 Query: 14 LFGR 3 LF R Sbjct: 84 LFSR 87 >ref|XP_002511605.1| hypothetical protein RCOM_1608690 [Ricinus communis] gi|223548785|gb|EEF50274.1| hypothetical protein RCOM_1608690 [Ricinus communis] Length = 638 Score = 65.1 bits (157), Expect = 6e-09 Identities = 26/35 (74%), Positives = 34/35 (97%) Frame = -3 Query: 113 FPSQAPDFITQSVLTEFWEIIHLLFIGIAVSYGLF 9 FPSQAP+F+ Q++LT+FWE++HLLFIG+AVSYGLF Sbjct: 41 FPSQAPNFVNQTLLTKFWELVHLLFIGVAVSYGLF 75 >gb|ADN34231.1| hypothetical protein [Cucumis melo subsp. melo] Length = 599 Score = 64.3 bits (155), Expect = 1e-08 Identities = 25/37 (67%), Positives = 34/37 (91%) Frame = -3 Query: 113 FPSQAPDFITQSVLTEFWEIIHLLFIGIAVSYGLFGR 3 FPS+AP+F+ Q++LT+FWE+ HL+F+GIAVSYGLF R Sbjct: 51 FPSEAPEFVNQTLLTKFWELFHLMFVGIAVSYGLFSR 87