BLASTX nr result
ID: Scutellaria23_contig00034046
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00034046 (279 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278486.2| PREDICTED: pentatricopeptide repeat-containi... 61 8e-08 >ref|XP_002278486.2| PREDICTED: pentatricopeptide repeat-containing protein At3g21470 [Vitis vinifera] Length = 575 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/58 (48%), Positives = 40/58 (68%) Frame = -2 Query: 176 LSNWSYSIRNFISQKKFKAAILTYIRHRSSGIMVIGAMPLVLKACASLSMLSFGRVLH 3 LSNW + IR+++SQ + A+L Y R G+ ++G PLVLKACASLS++ G+ LH Sbjct: 60 LSNWCHLIRSYLSQGAPREALLVYTGLRRKGVYLLGVAPLVLKACASLSIVKHGKALH 117