BLASTX nr result
ID: Scutellaria23_contig00034030
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00034030 (377 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510511.1| Auxin-induced protein 6B, putative [Ricinus ... 59 4e-07 ref|XP_004147834.1| PREDICTED: auxin-induced protein 6B-like [Cu... 57 2e-06 emb|CAN60527.1| hypothetical protein VITISV_000524 [Vitis vinifera] 55 6e-06 >ref|XP_002510511.1| Auxin-induced protein 6B, putative [Ricinus communis] gi|223551212|gb|EEF52698.1| Auxin-induced protein 6B, putative [Ricinus communis] Length = 151 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/53 (54%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Frame = +1 Query: 1 YLARMESTKSGPARFMTFEDFQRYCHVGIQSN-LKFLAETRPLLDGFSDKPIW 156 Y++R ES S R EDFQRYCHVG++S+ L F E+RPLL+G +DK IW Sbjct: 101 YISRSESGNS--TRLFNLEDFQRYCHVGVRSSKLDFWTESRPLLNGLADKTIW 151 >ref|XP_004147834.1| PREDICTED: auxin-induced protein 6B-like [Cucumis sativus] gi|449519840|ref|XP_004166942.1| PREDICTED: auxin-induced protein 6B-like [Cucumis sativus] Length = 150 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/52 (48%), Positives = 36/52 (69%) Frame = +1 Query: 1 YLARMESTKSGPARFMTFEDFQRYCHVGIQSNLKFLAETRPLLDGFSDKPIW 156 +++R ES SG RF+ +DFQ YCH+GI++ L E+RPLL G ++K IW Sbjct: 101 FISRSESPNSG--RFVKLDDFQSYCHIGIRTGLDLWPESRPLLHGLAEKSIW 150 >emb|CAN60527.1| hypothetical protein VITISV_000524 [Vitis vinifera] Length = 200 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/54 (51%), Positives = 39/54 (72%), Gaps = 2/54 (3%) Frame = +1 Query: 1 YLARMESTKSGPARFMTFEDFQRYCHVGIQSNLKFLAETRPLLDG--FSDKPIW 156 +++R E++ S ARF+ EDFQRYCHVGI+S+L F E+RPLL F+ K +W Sbjct: 105 FISRSEASNS--ARFVNREDFQRYCHVGIRSSLDFWPESRPLLHRVCFTPKNVW 156