BLASTX nr result
ID: Scutellaria23_contig00033851
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00033851 (410 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002315886.1| predicted protein [Populus trichocarpa] gi|2... 62 6e-08 ref|NP_177256.4| chaperone DnaJ-domain containing protein [Arabi... 55 8e-06 >ref|XP_002315886.1| predicted protein [Populus trichocarpa] gi|222864926|gb|EEF02057.1| predicted protein [Populus trichocarpa] Length = 175 Score = 61.6 bits (148), Expect = 6e-08 Identities = 38/98 (38%), Positives = 55/98 (56%), Gaps = 6/98 (6%) Frame = +3 Query: 3 GYADFVQEMVSLMNAAKKEEKNYSIEELQSMFWEMAQDFEXXXXXXXXXXPPYESQWFCD 182 G +DFVQE+++LM K+++K+YS+EELQ+M EMAQ FE S W+C Sbjct: 90 GLSDFVQEILNLMAQDKRQDKSYSMEELQTMLSEMAQGFE-------------TSSWYCT 136 Query: 183 PYSSLYESGSNS----CEAS--MIQGDPHLSFEAFGMH 278 P S+ E NS C+A M +G H S +G++ Sbjct: 137 P--SILEEPRNSKRARCDADPMMDRGSSHFSLSGWGVY 172 >ref|NP_177256.4| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] gi|332197028|gb|AEE35149.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] Length = 165 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +3 Query: 3 GYADFVQEMVSLMNAAKKEEKNYSIEELQSMFWEMAQDFE 122 GY DFVQEMVSLM+ K+EEK YS+EELQ+M +M +F+ Sbjct: 85 GYFDFVQEMVSLMSQTKREEKQYSLEELQTMVDDMVYEFQ 124