BLASTX nr result
ID: Scutellaria23_contig00033619
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00033619 (255 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABY49799.1| membrane receptor-like protein 1 [Capsicum annuum] 62 5e-08 dbj|BAC57589.1| membrane located receptor-like protein [Nicotian... 62 5e-08 >gb|ABY49799.1| membrane receptor-like protein 1 [Capsicum annuum] Length = 315 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 2/62 (3%) Frame = +1 Query: 1 SIYDALGNGFELSWFR-VLCRDCERNDGECSLDGKDIT-CKYYCKEDTPIYKRSFKCQFE 174 SI+ AL GFEL+W LCR C R+D + D+ C++YCKEDTP+ +RSF C+ E Sbjct: 199 SIHQALAYGFELTWRSDFLCRRCSRDDTCILEEDNDVPICRHYCKEDTPVSERSFGCKVE 258 Query: 175 YW 180 Y+ Sbjct: 259 YY 260 >dbj|BAC57589.1| membrane located receptor-like protein [Nicotiana tabacum] Length = 308 Score = 62.0 bits (149), Expect = 5e-08 Identities = 29/64 (45%), Positives = 44/64 (68%), Gaps = 4/64 (6%) Frame = +1 Query: 1 SIYDALGNGFELSWFR-VLCRDCERN-DGECSLDGKD--ITCKYYCKEDTPIYKRSFKCQ 168 S + L GFELSW R +LCR+C+R+ GEC+++ TC+Y+CKED + K +F+C+ Sbjct: 196 STHQGLAYGFELSWKRNLLCRNCDRSRGGECTIEENSDRATCRYWCKEDIHVSKLTFRCK 255 Query: 169 FEYW 180 EY+ Sbjct: 256 VEYY 259