BLASTX nr result
ID: Scutellaria23_contig00033177
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00033177 (297 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511058.1| tyrosyl-DNA phosphodiesterase, putative [Ric... 64 1e-08 ref|XP_002318192.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 >ref|XP_002511058.1| tyrosyl-DNA phosphodiesterase, putative [Ricinus communis] gi|223550173|gb|EEF51660.1| tyrosyl-DNA phosphodiesterase, putative [Ricinus communis] Length = 1148 Score = 64.3 bits (155), Expect = 1e-08 Identities = 33/59 (55%), Positives = 40/59 (67%), Gaps = 2/59 (3%) Frame = +3 Query: 21 RAKYSTNGVFVNGSRIS-GFV-ELRVGDVVWFVCGNEKACQLGASIGFMVEKAVFSEEV 191 R ++S NGVF+NG R+ G V EL GD V FVCGNE C LG IGF+++ VF EEV Sbjct: 156 RIRFSMNGVFINGIRVKRGIVRELCTGDEVLFVCGNEGLCNLGVRIGFLIQGVVFKEEV 214 >ref|XP_002318192.1| predicted protein [Populus trichocarpa] gi|222858865|gb|EEE96412.1| predicted protein [Populus trichocarpa] Length = 1131 Score = 56.6 bits (135), Expect = 2e-06 Identities = 31/55 (56%), Positives = 35/55 (63%), Gaps = 2/55 (3%) Frame = +3 Query: 33 STNGVFVNGSRIS-GFV-ELRVGDVVWFVCGNEKACQLGASIGFMVEKAVFSEEV 191 S NGVFVNG R+ G V EL GD V VCGNE C LG IGF+++ F EEV Sbjct: 152 SLNGVFVNGVRVKKGMVRELCAGDEVLLVCGNEGNCSLGGRIGFLIKGVAFKEEV 206