BLASTX nr result
ID: Scutellaria23_contig00033167
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00033167 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002330857.1| predicted protein [Populus trichocarpa] gi|2... 77 1e-12 dbj|BAF80452.1| DC1 domain containing protein [Nicotiana tabacum] 76 3e-12 ref|XP_002512181.1| protein binding protein, putative [Ricinus c... 69 3e-10 ref|XP_004151553.1| PREDICTED: probable nucleoredoxin 1-1-like [... 68 7e-10 pir||T08861 hypothetical protein A_TM017A05.3 - Arabidopsis thal... 67 2e-09 >ref|XP_002330857.1| predicted protein [Populus trichocarpa] gi|222872679|gb|EEF09810.1| predicted protein [Populus trichocarpa] Length = 190 Score = 77.0 bits (188), Expect = 1e-12 Identities = 29/61 (47%), Positives = 45/61 (73%) Frame = +3 Query: 57 MKHFIHRHPLKQVEIQQKNGTVCSACEWEISGSAYYCTQPHCSFKIDKACFDSPREIRHK 236 +KHF H HPL+ V+++++ ++CS CE ++SGSAY CT+ C F + K+CF+ PRE+ H Sbjct: 17 VKHFSHSHPLRPVDVKEEEESICSGCELDLSGSAYKCTKSTCDFFLHKSCFELPRELEHT 76 Query: 237 S 239 S Sbjct: 77 S 77 >dbj|BAF80452.1| DC1 domain containing protein [Nicotiana tabacum] Length = 236 Score = 75.9 bits (185), Expect = 3e-12 Identities = 30/61 (49%), Positives = 44/61 (72%) Frame = +3 Query: 57 MKHFIHRHPLKQVEIQQKNGTVCSACEWEISGSAYYCTQPHCSFKIDKACFDSPREIRHK 236 MKHF H H L+ E+Q+ N +CS CE ++SG +Y CT+P+C F + K+CF+ PR+I+H Sbjct: 1 MKHFSHPHALELSEVQETNEIICSGCENKLSGISYKCTKPNCKFTLHKSCFELPRKIQHN 60 Query: 237 S 239 S Sbjct: 61 S 61 >ref|XP_002512181.1| protein binding protein, putative [Ricinus communis] gi|223548725|gb|EEF50215.1| protein binding protein, putative [Ricinus communis] Length = 187 Score = 69.3 bits (168), Expect = 3e-10 Identities = 25/61 (40%), Positives = 42/61 (68%) Frame = +3 Query: 57 MKHFIHRHPLKQVEIQQKNGTVCSACEWEISGSAYYCTQPHCSFKIDKACFDSPREIRHK 236 +KHF H HPL+ ++++ +C CE ++SGSAY C++ C F + K+CF+ P+E++H Sbjct: 16 VKHFSHSHPLRPADVKEDEEIICFGCELDLSGSAYKCSKSKCVFLLHKSCFELPKELQHD 75 Query: 237 S 239 S Sbjct: 76 S 76 >ref|XP_004151553.1| PREDICTED: probable nucleoredoxin 1-1-like [Cucumis sativus] gi|449524190|ref|XP_004169106.1| PREDICTED: probable nucleoredoxin 1-1-like [Cucumis sativus] Length = 179 Score = 68.2 bits (165), Expect = 7e-10 Identities = 27/62 (43%), Positives = 40/62 (64%) Frame = +3 Query: 54 IMKHFIHRHPLKQVEIQQKNGTVCSACEWEISGSAYYCTQPHCSFKIDKACFDSPREIRH 233 + +HF H HPL + + +GT+CSACE+ +SG+A+ C++P C F + CF P EI H Sbjct: 2 LKQHFSHPHPLAAATLVEDDGTLCSACEFPLSGAAFKCSKPKCEFHLHDLCFALPPEIHH 61 Query: 234 KS 239 S Sbjct: 62 PS 63 >pir||T08861 hypothetical protein A_TM017A05.3 - Arabidopsis thaliana Length = 457 Score = 66.6 bits (161), Expect = 2e-09 Identities = 27/69 (39%), Positives = 44/69 (63%) Frame = +3 Query: 33 PQSQSQTIMKHFIHRHPLKQVEIQQKNGTVCSACEWEISGSAYYCTQPHCSFKIDKACFD 212 P S+ ++H H HPL+ + Q ++ +CS C+ ++ G+ + CT+ C + + K+CFD Sbjct: 208 PLMASRPSVRHPSHNHPLRGHKAQVEDEIICSGCDLDLLGAYFKCTKSECDYFLHKSCFD 267 Query: 213 SPREIRHKS 239 PREIRHKS Sbjct: 268 LPREIRHKS 276