BLASTX nr result
ID: Scutellaria23_contig00033157
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00033157 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528200.1| regulator of telomere elongation helicase 1 ... 107 1e-21 ref|XP_002279773.2| PREDICTED: regulator of telomere elongation ... 102 4e-20 ref|XP_004141849.1| PREDICTED: regulator of telomere elongation ... 92 3e-17 ref|XP_003542103.1| PREDICTED: regulator of telomere elongation ... 91 1e-16 emb|CBI36155.3| unnamed protein product [Vitis vinifera] 90 2e-16 >ref|XP_002528200.1| regulator of telomere elongation helicase 1 rtel1, putative [Ricinus communis] gi|223532412|gb|EEF34207.1| regulator of telomere elongation helicase 1 rtel1, putative [Ricinus communis] Length = 1049 Score = 107 bits (267), Expect = 1e-21 Identities = 58/96 (60%), Positives = 70/96 (72%) Frame = +1 Query: 10 DDENITKKRTVELNIVKQEDFKPQTVPHNNDETKGSAFLIQVREKLTDAEYKEFVEFMKA 189 +D IT+K EL K + + VP +++E +GSAFLIQV+EKLT AEYKEFV FMKA Sbjct: 900 NDRGITRKVDTELLTQKSKGVQTTLVPCSDEEKRGSAFLIQVKEKLTAAEYKEFVGFMKA 959 Query: 190 LKSKAMKIGNVLQSIAILFSVPGRLSLLHGFKDYIP 297 LKSKAM+IG+VL+SI LFS P R LL FKDYIP Sbjct: 960 LKSKAMQIGSVLESIVKLFSGPDRFPLLKRFKDYIP 995 >ref|XP_002279773.2| PREDICTED: regulator of telomere elongation helicase 1-like [Vitis vinifera] Length = 1084 Score = 102 bits (253), Expect = 4e-20 Identities = 57/94 (60%), Positives = 68/94 (72%) Frame = +1 Query: 16 ENITKKRTVELNIVKQEDFKPQTVPHNNDETKGSAFLIQVREKLTDAEYKEFVEFMKALK 195 E+ + K+ E K + + +P + ET+GSAFLIQV+EKL+ AEYKEFV FMKALK Sbjct: 940 EDDSPKKDAEFLSQKGKGVQSSPLPCSVKETRGSAFLIQVQEKLSTAEYKEFVGFMKALK 999 Query: 196 SKAMKIGNVLQSIAILFSVPGRLSLLHGFKDYIP 297 SKAMKIG VL+SIA LFS P RL LL FKDYIP Sbjct: 1000 SKAMKIGQVLESIARLFSGPERLPLLKRFKDYIP 1033 >ref|XP_004141849.1| PREDICTED: regulator of telomere elongation helicase 1-like [Cucumis sativus] Length = 1054 Score = 92.4 bits (228), Expect = 3e-17 Identities = 53/83 (63%), Positives = 60/83 (72%), Gaps = 2/83 (2%) Frame = +1 Query: 55 VKQED--FKPQTVPHNNDETKGSAFLIQVREKLTDAEYKEFVEFMKALKSKAMKIGNVLQ 228 VKQ + K TV ++E KGS FL QVREKL+D EYKEFV FMKALK+KAM I +VLQ Sbjct: 957 VKQNEKIVKCVTVQPGDEEAKGSDFLSQVREKLSDREYKEFVGFMKALKTKAMGITHVLQ 1016 Query: 229 SIAILFSVPGRLSLLHGFKDYIP 297 SI +FS P RL L GFKDYIP Sbjct: 1017 SIVRIFSGPDRLRLRTGFKDYIP 1039 >ref|XP_003542103.1| PREDICTED: regulator of telomere elongation helicase 1-like [Glycine max] Length = 1001 Score = 90.5 bits (223), Expect = 1e-16 Identities = 50/85 (58%), Positives = 60/85 (70%), Gaps = 1/85 (1%) Frame = +1 Query: 46 LNIVKQEDFKPQT-VPHNNDETKGSAFLIQVREKLTDAEYKEFVEFMKALKSKAMKIGNV 222 L +++Q+ P VP DETKGSAFL QVR+KL+ AEY FV +MKALK+K MKI V Sbjct: 903 LELIRQKGNLPDDFVPSVGDETKGSAFLAQVRDKLSAAEYINFVGYMKALKTKTMKISEV 962 Query: 223 LQSIAILFSVPGRLSLLHGFKDYIP 297 LQ I+ LF+ P RL LL FKDYIP Sbjct: 963 LQCISRLFTGPDRLPLLKRFKDYIP 987 >emb|CBI36155.3| unnamed protein product [Vitis vinifera] Length = 335 Score = 90.1 bits (222), Expect = 2e-16 Identities = 51/90 (56%), Positives = 64/90 (71%) Frame = +1 Query: 16 ENITKKRTVELNIVKQEDFKPQTVPHNNDETKGSAFLIQVREKLTDAEYKEFVEFMKALK 195 E+ + K+ E K + + +P + ET+GSAFLIQV+EKL+ AEYKEFV FMKALK Sbjct: 240 EDDSPKKDAEFLSQKGKGVQSSPLPCSVKETRGSAFLIQVQEKLSTAEYKEFVGFMKALK 299 Query: 196 SKAMKIGNVLQSIAILFSVPGRLSLLHGFK 285 SKAMKIG VL+SIA LFS P RL LL ++ Sbjct: 300 SKAMKIGQVLESIARLFSGPERLPLLKRYE 329