BLASTX nr result
ID: Scutellaria23_contig00033144
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00033144 (293 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADN34174.1| auxin-regulated protein [Cucumis melo subsp. melo] 62 5e-08 ref|XP_002320183.1| GH3 family protein [Populus trichocarpa] gi|... 62 6e-08 ref|XP_002301399.1| GH3 family protein [Populus trichocarpa] gi|... 62 6e-08 gb|ABK95237.1| unknown [Populus trichocarpa] 62 6e-08 ref|XP_003548507.1| PREDICTED: probable indole-3-acetic acid-ami... 61 8e-08 >gb|ADN34174.1| auxin-regulated protein [Cucumis melo subsp. melo] Length = 575 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 291 AVSQFKTPRCIGPTNKKVMQILCSNVVKSYFSTAY 187 AVSQ+KTPRC+ PTN V+QILCSNVV SYFSTAY Sbjct: 541 AVSQYKTPRCVIPTNTAVLQILCSNVVNSYFSTAY 575 >ref|XP_002320183.1| GH3 family protein [Populus trichocarpa] gi|222860956|gb|EEE98498.1| GH3 family protein [Populus trichocarpa] Length = 576 Score = 61.6 bits (148), Expect = 6e-08 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 288 VSQFKTPRCIGPTNKKVMQILCSNVVKSYFSTAY 187 VSQFKTPRC+GP N KV QILC+NV K+YFSTA+ Sbjct: 543 VSQFKTPRCVGPMNSKVQQILCNNVAKTYFSTAF 576 >ref|XP_002301399.1| GH3 family protein [Populus trichocarpa] gi|222843125|gb|EEE80672.1| GH3 family protein [Populus trichocarpa] Length = 576 Score = 61.6 bits (148), Expect = 6e-08 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 288 VSQFKTPRCIGPTNKKVMQILCSNVVKSYFSTAY 187 VSQFKTPRC+GP N KV QILC+NV K+YFSTA+ Sbjct: 543 VSQFKTPRCVGPMNNKVQQILCNNVAKTYFSTAF 576 >gb|ABK95237.1| unknown [Populus trichocarpa] Length = 576 Score = 61.6 bits (148), Expect = 6e-08 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 288 VSQFKTPRCIGPTNKKVMQILCSNVVKSYFSTAY 187 VSQFKTPRC+GP N KV QILC+NV K+YFSTA+ Sbjct: 543 VSQFKTPRCVGPMNNKVQQILCNNVAKTYFSTAF 576 >ref|XP_003548507.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.5-like [Glycine max] Length = 582 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 291 AVSQFKTPRCIGPTNKKVMQILCSNVVKSYFSTAY 187 AVSQFKTPRC+GPTN KV+QIL NVVKSY STA+ Sbjct: 547 AVSQFKTPRCVGPTNTKVLQILNENVVKSYLSTAF 581