BLASTX nr result
ID: Scutellaria23_contig00033138
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00033138 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322401.1| predicted protein [Populus trichocarpa] gi|2... 84 2e-14 ref|XP_002318285.1| predicted protein [Populus trichocarpa] gi|2... 75 7e-12 ref|XP_002280446.1| PREDICTED: pectinesterase 2 [Vitis vinifera] 74 9e-12 ref|XP_003634048.1| PREDICTED: pectinesterase 2-like isoform 2 [... 74 1e-11 ref|XP_002322402.1| predicted protein [Populus trichocarpa] gi|2... 71 1e-10 >ref|XP_002322401.1| predicted protein [Populus trichocarpa] gi|222869397|gb|EEF06528.1| predicted protein [Populus trichocarpa] Length = 517 Score = 83.6 bits (205), Expect = 2e-14 Identities = 39/70 (55%), Positives = 49/70 (70%) Frame = +3 Query: 66 AQSHTTPSDITSWCSQTPYPDQCKYFMTRNPNPHKYVPKHKSDFRKMAIELALRRAIKAE 245 + S + I WCS+TP P+ CKYFM +NP +VPK KSDFRKMAIELA++RA+ A+ Sbjct: 19 SSSIASNDQIDYWCSKTPNPEPCKYFMKQNPK--HFVPKQKSDFRKMAIELAVQRALNAQ 76 Query: 246 GHTKTLGKKC 275 H K LG KC Sbjct: 77 NHNKWLGPKC 86 >ref|XP_002318285.1| predicted protein [Populus trichocarpa] gi|222858958|gb|EEE96505.1| predicted protein [Populus trichocarpa] Length = 520 Score = 74.7 bits (182), Expect = 7e-12 Identities = 34/61 (55%), Positives = 44/61 (72%) Frame = +3 Query: 93 ITSWCSQTPYPDQCKYFMTRNPNPHKYVPKHKSDFRKMAIELALRRAIKAEGHTKTLGKK 272 I WC++TP P+ CKYFM +NP +VP+ KSDFRK+AIEL+++RA A H K LG K Sbjct: 31 IDYWCNKTPNPEPCKYFMKQNPK--HFVPQQKSDFRKLAIELSMQRAHTALSHNKGLGSK 88 Query: 273 C 275 C Sbjct: 89 C 89 >ref|XP_002280446.1| PREDICTED: pectinesterase 2 [Vitis vinifera] Length = 513 Score = 74.3 bits (181), Expect = 9e-12 Identities = 33/62 (53%), Positives = 47/62 (75%) Frame = +3 Query: 90 DITSWCSQTPYPDQCKYFMTRNPNPHKYVPKHKSDFRKMAIELALRRAIKAEGHTKTLGK 269 D+ SWCSQTPYP C+YF++ P+ H + K KSDF K++++LAL RA++AE +T +LG Sbjct: 24 DVKSWCSQTPYPQPCEYFLSHKPD-HSPI-KQKSDFLKISMQLALERALRAESNTYSLGS 81 Query: 270 KC 275 KC Sbjct: 82 KC 83 >ref|XP_003634048.1| PREDICTED: pectinesterase 2-like isoform 2 [Vitis vinifera] Length = 520 Score = 73.9 bits (180), Expect = 1e-11 Identities = 33/63 (52%), Positives = 44/63 (69%), Gaps = 1/63 (1%) Frame = +3 Query: 90 DITSWCSQTPYPDQCKYFMTRNPNPHKY-VPKHKSDFRKMAIELALRRAIKAEGHTKTLG 266 D+ WC +TPYP CKYFM+ HKY PK KS+F+KMA+++A+ RA+ A+ H K LG Sbjct: 29 DVNWWCDKTPYPAPCKYFMSHGG--HKYNAPKKKSEFQKMAMQVAMERALTAQSHNKWLG 86 Query: 267 KKC 275 KC Sbjct: 87 SKC 89 >ref|XP_002322402.1| predicted protein [Populus trichocarpa] gi|222869398|gb|EEF06529.1| predicted protein [Populus trichocarpa] Length = 524 Score = 70.9 bits (172), Expect = 1e-10 Identities = 32/70 (45%), Positives = 47/70 (67%) Frame = +3 Query: 66 AQSHTTPSDITSWCSQTPYPDQCKYFMTRNPNPHKYVPKHKSDFRKMAIELALRRAIKAE 245 A S +T S+IT WC+QTP+P CKYFM+ + H + KH+S FR M+++LAL +A+ A+ Sbjct: 21 AASKSTKSNITWWCNQTPHPSTCKYFMSH--SHHHFALKHRSKFRLMSVQLALEKALIAQ 78 Query: 246 GHTKTLGKKC 275 LG+ C Sbjct: 79 RQVSQLGQNC 88