BLASTX nr result
ID: Scutellaria23_contig00033129
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00033129 (346 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004160916.1| PREDICTED: ABC transporter G family member 2... 112 4e-23 ref|XP_004139550.1| PREDICTED: ABC transporter G family member 2... 112 4e-23 ref|XP_003540763.1| PREDICTED: ABC transporter G family member 2... 109 3e-22 ref|XP_003539196.1| PREDICTED: ABC transporter G family member 2... 104 7e-21 ref|NP_200882.4| ABC transporter G family member 28 [Arabidopsis... 99 5e-19 >ref|XP_004160916.1| PREDICTED: ABC transporter G family member 28-like [Cucumis sativus] Length = 1154 Score = 112 bits (279), Expect = 4e-23 Identities = 50/68 (73%), Positives = 57/68 (83%) Frame = +1 Query: 1 CYTKWALEAFLLANAERYSGVWLIQRCGALKQRGYDLKHYYPSLACLLATGIASRGLAFF 180 CYTKWALEAF++ANA+RYSGVWLI RCG+L Q YDLK++Y L CL ATG SRG AFF Sbjct: 1087 CYTKWALEAFVIANAKRYSGVWLITRCGSLMQNRYDLKNWYKCLICLFATGAISRGTAFF 1146 Query: 181 CLVTFQKK 204 C+VTFQKK Sbjct: 1147 CMVTFQKK 1154 >ref|XP_004139550.1| PREDICTED: ABC transporter G family member 28-like [Cucumis sativus] Length = 1108 Score = 112 bits (279), Expect = 4e-23 Identities = 50/68 (73%), Positives = 57/68 (83%) Frame = +1 Query: 1 CYTKWALEAFLLANAERYSGVWLIQRCGALKQRGYDLKHYYPSLACLLATGIASRGLAFF 180 CYTKWALEAF++ANA+RYSGVWLI RCG+L Q YDLK++Y L CL ATG SRG AFF Sbjct: 1041 CYTKWALEAFVIANAKRYSGVWLITRCGSLMQNRYDLKNWYKCLICLFATGAISRGTAFF 1100 Query: 181 CLVTFQKK 204 C+VTFQKK Sbjct: 1101 CMVTFQKK 1108 >ref|XP_003540763.1| PREDICTED: ABC transporter G family member 28-like [Glycine max] Length = 1128 Score = 109 bits (272), Expect = 3e-22 Identities = 47/68 (69%), Positives = 57/68 (83%) Frame = +1 Query: 1 CYTKWALEAFLLANAERYSGVWLIQRCGALKQRGYDLKHYYPSLACLLATGIASRGLAFF 180 CYTKWALEAF+++NA+RY+GVWL+ RCGAL GYDLKH+Y L L+ TGI SR LAFF Sbjct: 1061 CYTKWALEAFVISNAKRYTGVWLLSRCGALYTNGYDLKHWYQCLGLLIVTGIISRMLAFF 1120 Query: 181 CLVTFQKK 204 C++TFQKK Sbjct: 1121 CMITFQKK 1128 >ref|XP_003539196.1| PREDICTED: ABC transporter G family member 28-like [Glycine max] Length = 1200 Score = 104 bits (260), Expect = 7e-21 Identities = 46/68 (67%), Positives = 55/68 (80%) Frame = +1 Query: 1 CYTKWALEAFLLANAERYSGVWLIQRCGALKQRGYDLKHYYPSLACLLATGIASRGLAFF 180 CYTKWALEAF+++NA+RY+GVWLI RCGAL GYDLKH+Y L L+ GI SR LAF Sbjct: 1133 CYTKWALEAFVISNAKRYTGVWLISRCGALYTNGYDLKHWYQCLGLLIVMGIISRMLAFS 1192 Query: 181 CLVTFQKK 204 C++TFQKK Sbjct: 1193 CMITFQKK 1200 >ref|NP_200882.4| ABC transporter G family member 28 [Arabidopsis thaliana] gi|75333734|sp|Q9FF46.1|AB28G_ARATH RecName: Full=ABC transporter G family member 28; Short=ABC transporter ABCG.28; Short=AtABCG28; AltName: Full=Putative white-brown complex homolog protein 29; Short=AtWBC29 gi|9759338|dbj|BAB09847.1| ABC transporter-like protein [Arabidopsis thaliana] gi|332009989|gb|AED97372.1| ABC transporter G family member 28 [Arabidopsis thaliana] Length = 1109 Score = 98.6 bits (244), Expect = 5e-19 Identities = 43/68 (63%), Positives = 54/68 (79%) Frame = +1 Query: 1 CYTKWALEAFLLANAERYSGVWLIQRCGALKQRGYDLKHYYPSLACLLATGIASRGLAFF 180 CYT+WALEAF+++NA+RY GVWLI RCG+L + GY++KH+ L L TGI SR AFF Sbjct: 1042 CYTRWALEAFVVSNAQRYKGVWLITRCGSLMENGYNIKHFPRCLVFLTLTGILSRCAAFF 1101 Query: 181 CLVTFQKK 204 C+VTFQKK Sbjct: 1102 CMVTFQKK 1109