BLASTX nr result
ID: Scutellaria23_contig00033033
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00033033 (306 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN73939.1| hypothetical protein VITISV_031601 [Vitis vinifera] 56 3e-06 >emb|CAN73939.1| hypothetical protein VITISV_031601 [Vitis vinifera] Length = 1452 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/47 (59%), Positives = 36/47 (76%), Gaps = 1/47 (2%) Frame = -2 Query: 158 EVESSSDSSAKLPQE-VIYLDDIEELVTPVIKNGSLQDQRLFMFRSF 21 + +SSS+SS + P+E V+YLDDIEE +P K+ S QDQRLFMF SF Sbjct: 1094 DAKSSSESSYQFPEEEVVYLDDIEEFQSPRTKDSSFQDQRLFMFNSF 1140