BLASTX nr result
ID: Scutellaria23_contig00032568
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00032568 (186 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283562.1| PREDICTED: pentatricopeptide repeat-containi... 54 5e-06 >ref|XP_002283562.1| PREDICTED: pentatricopeptide repeat-containing protein At5g43790-like [Vitis vinifera] Length = 590 Score = 53.9 bits (128), Expect(2) = 5e-06 Identities = 25/52 (48%), Positives = 35/52 (67%) Frame = -1 Query: 156 SHLMPHSERSSGALSLYDQVLYDPNIKPNNYTYPSLFKAFGACQWFKHGRAL 1 +++ PH+ A SLY +VL +KPN +T+PSLFKA G+ W +HGRAL Sbjct: 82 ANIKPHTHI---AFSLYSRVLTHTTLKPNGFTFPSLFKACGSQPWLRHGRAL 130 Score = 21.2 bits (43), Expect(2) = 5e-06 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -2 Query: 185 PNLSIFLRKTLISCL 141 PN +IFL TLIS L Sbjct: 67 PNPTIFLYNTLISSL 81