BLASTX nr result
ID: Scutellaria23_contig00032551
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00032551 (230 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515304.1| triacylglycerol lipase, putative [Ricinus co... 55 6e-06 >ref|XP_002515304.1| triacylglycerol lipase, putative [Ricinus communis] gi|223545784|gb|EEF47288.1| triacylglycerol lipase, putative [Ricinus communis] Length = 727 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/62 (45%), Positives = 36/62 (58%) Frame = +1 Query: 28 MDALCLKAGIHGMAAPPIASAGNVELRLPAAAADKPSVSATPPRSLPWGFTFRHPLRSLW 207 MD+LCLK GIH + G L + A A+ VSATPP+ F+FR+PL+S W Sbjct: 1 MDSLCLKPGIHSITPSISVGGGGAALEVRANASQ---VSATPPQKAASRFSFRYPLQSFW 57 Query: 208 PG 213 PG Sbjct: 58 PG 59