BLASTX nr result
ID: Scutellaria23_contig00032298
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00032298 (231 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267809.2| PREDICTED: pentatricopeptide repeat-containi... 104 7e-21 emb|CAN69960.1| hypothetical protein VITISV_032887 [Vitis vinifera] 104 7e-21 ref|XP_003530173.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 90 2e-16 ref|NP_973481.1| pentatricopeptide repeat-containing protein [Ar... 89 3e-16 ref|NP_565422.1| pentatricopeptide repeat-containing protein [Ar... 89 3e-16 >ref|XP_002267809.2| PREDICTED: pentatricopeptide repeat-containing protein At2g17670-like [Vitis vinifera] Length = 458 Score = 104 bits (260), Expect = 7e-21 Identities = 47/74 (63%), Positives = 61/74 (82%) Frame = -2 Query: 224 LNLMSNSGFPPNQVSTDVAVRALCGCGREEHAIELVKELCAKNSPPDTYTYNFMVRHLVK 45 LNLM GFPP++V+TD+AVR+LC GREEHAIELVKEL K+SPPD++TYNF++RHL K Sbjct: 224 LNLMVTHGFPPDRVTTDIAVRSLCSAGREEHAIELVKELSLKHSPPDSFTYNFIIRHLCK 283 Query: 44 NRSIDTVNCFIKDM 3 R++ TV FI ++ Sbjct: 284 TRALSTVYNFIDEL 297 >emb|CAN69960.1| hypothetical protein VITISV_032887 [Vitis vinifera] Length = 472 Score = 104 bits (260), Expect = 7e-21 Identities = 47/74 (63%), Positives = 61/74 (82%) Frame = -2 Query: 224 LNLMSNSGFPPNQVSTDVAVRALCGCGREEHAIELVKELCAKNSPPDTYTYNFMVRHLVK 45 LNLM GFPP++V+TD+AVR+LC GREEHAIELVKEL K+SPPD++TYNF++RHL K Sbjct: 156 LNLMVTHGFPPDRVTTDIAVRSLCSAGREEHAIELVKELSLKHSPPDSFTYNFIIRHLCK 215 Query: 44 NRSIDTVNCFIKDM 3 R++ TV FI ++ Sbjct: 216 TRALSTVYNFIDEL 229 >ref|XP_003530173.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g17670-like [Glycine max] Length = 456 Score = 90.1 bits (222), Expect = 2e-16 Identities = 40/74 (54%), Positives = 55/74 (74%) Frame = -2 Query: 224 LNLMSNSGFPPNQVSTDVAVRALCGCGREEHAIELVKELCAKNSPPDTYTYNFMVRHLVK 45 LNLM +G P+ + DVAVR+LC GR +HA+EL+KE +K+ PPDTYT+NF+V+HL K Sbjct: 138 LNLMLAAGITPDTATADVAVRSLCSAGRLDHAVELIKEFASKHCPPDTYTFNFLVKHLCK 197 Query: 44 NRSIDTVNCFIKDM 3 + +I TV FI +M Sbjct: 198 SSTITTVYAFIDEM 211 >ref|NP_973481.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|330251569|gb|AEC06663.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 349 Score = 89.4 bits (220), Expect = 3e-16 Identities = 41/75 (54%), Positives = 57/75 (76%) Frame = -2 Query: 227 VLNLMSNSGFPPNQVSTDVAVRALCGCGREEHAIELVKELCAKNSPPDTYTYNFMVRHLV 48 VLNLM N+G P+QV+TD+AVR+LC GR + A +L+KEL K+SPPDTYTYNF+++HL Sbjct: 146 VLNLMVNNGLEPDQVTTDIAVRSLCETGRVDEAKDLMKELTEKHSPPDTYTYNFLLKHLC 205 Query: 47 KNRSIDTVNCFIKDM 3 K + + V F+ +M Sbjct: 206 KCKDLHVVYEFVDEM 220 >ref|NP_565422.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75146596|sp|Q84J71.1|PP161_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g17670 gi|28393395|gb|AAO42121.1| unknown protein [Arabidopsis thaliana] gi|28973597|gb|AAO64123.1| unknown protein [Arabidopsis thaliana] gi|330251570|gb|AEC06664.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 463 Score = 89.4 bits (220), Expect = 3e-16 Identities = 41/75 (54%), Positives = 57/75 (76%) Frame = -2 Query: 227 VLNLMSNSGFPPNQVSTDVAVRALCGCGREEHAIELVKELCAKNSPPDTYTYNFMVRHLV 48 VLNLM N+G P+QV+TD+AVR+LC GR + A +L+KEL K+SPPDTYTYNF+++HL Sbjct: 146 VLNLMVNNGLEPDQVTTDIAVRSLCETGRVDEAKDLMKELTEKHSPPDTYTYNFLLKHLC 205 Query: 47 KNRSIDTVNCFIKDM 3 K + + V F+ +M Sbjct: 206 KCKDLHVVYEFVDEM 220