BLASTX nr result
ID: Scutellaria23_contig00032211
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00032211 (390 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533891.1| pentatricopeptide repeat-containing protein,... 64 1e-08 ref|XP_002278184.1| PREDICTED: pentatricopeptide repeat-containi... 60 1e-07 ref|XP_004147925.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 ref|XP_003529141.1| PREDICTED: pentatricopeptide repeat-containi... 57 1e-06 gb|ACU25679.1| pentatricopeptide repeat-containing protein [Priv... 57 2e-06 >ref|XP_002533891.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223526155|gb|EEF28491.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 701 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = -3 Query: 388 TFKGLCSCNRISSAISFLHNALTNKVVPTIVTWNILIRAIIHSRT 254 T KGLCSC+RIS AI FL++AL ++PT VTWNIL+RA ++ RT Sbjct: 647 TIKGLCSCSRISDAIEFLNDALNRGILPTAVTWNILVRAAVNFRT 691 >ref|XP_002278184.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09060 [Vitis vinifera] Length = 691 Score = 60.5 bits (145), Expect = 1e-07 Identities = 25/46 (54%), Positives = 36/46 (78%) Frame = -3 Query: 388 TFKGLCSCNRISSAISFLHNALTNKVVPTIVTWNILIRAIIHSRTL 251 T KGLCSC+RIS A+ FL++A+ V+PT +TWNIL+RA++ + L Sbjct: 645 TLKGLCSCHRISDAVGFLNDAVDRGVLPTAITWNILVRAVLDNGAL 690 >ref|XP_004147925.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09060-like [Cucumis sativus] gi|449516585|ref|XP_004165327.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09060-like [Cucumis sativus] Length = 701 Score = 59.7 bits (143), Expect = 2e-07 Identities = 24/46 (52%), Positives = 34/46 (73%) Frame = -3 Query: 388 TFKGLCSCNRISSAISFLHNALTNKVVPTIVTWNILIRAIIHSRTL 251 TFKGLCSC R+S AI FL++AL ++P TWN+L+RA++ + L Sbjct: 645 TFKGLCSCARVSDAIEFLYDALDRGILPNAPTWNVLVRAVVDDKPL 690 >ref|XP_003529141.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09060-like [Glycine max] Length = 682 Score = 57.4 bits (137), Expect = 1e-06 Identities = 23/41 (56%), Positives = 31/41 (75%) Frame = -3 Query: 388 TFKGLCSCNRISSAISFLHNALTNKVVPTIVTWNILIRAII 266 T KGLCSC R++ A+ FL +AL +PT +TWNIL+RA+I Sbjct: 641 TLKGLCSCGRVTDAVGFLDDALVRGFLPTAITWNILVRAVI 681 >gb|ACU25679.1| pentatricopeptide repeat-containing protein [Priva cordifolia] Length = 376 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -3 Query: 388 TFKGLCSCNRISSAISFLHNALTNKVVPTIVT 293 T KGLCSCNRIS AI FLH+ALT K+VPTI+T Sbjct: 345 TLKGLCSCNRISGAILFLHDALTKKIVPTIIT 376