BLASTX nr result
ID: Scutellaria23_contig00032140
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00032140 (247 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF07830.1|AC010871_6 putative SCO1 protein [Arabidopsis thal... 58 7e-07 ref|NP_566339.1| electron transport SCO1/SenC-like protein [Arab... 58 7e-07 ref|XP_002882593.1| electron transport SCO1/SenC family protein ... 57 1e-06 >gb|AAF07830.1|AC010871_6 putative SCO1 protein [Arabidopsis thaliana] Length = 273 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 156 PVSWMSFFLLLCTGAGLVYYYDSVKRRHIE 245 PVSWMSFFLL TGAGLVYYYD+ K+RHIE Sbjct: 63 PVSWMSFFLLFATGAGLVYYYDTQKKRHIE 92 >ref|NP_566339.1| electron transport SCO1/SenC-like protein [Arabidopsis thaliana] gi|75161513|sp|Q8VYP0.1|SCO11_ARATH RecName: Full=Protein SCO1 homolog 1, mitochondrial; AltName: Full=Homolog of the copper chaperone SCO1 member 1; Short=HCC1; Flags: Precursor gi|17979327|gb|AAL49889.1| putative SCO1 protein [Arabidopsis thaliana] gi|20465763|gb|AAM20370.1| putative SCO1 protein [Arabidopsis thaliana] gi|21553398|gb|AAM62491.1| putative SCO1 protein [Arabidopsis thaliana] gi|332641180|gb|AEE74701.1| electron transport SCO1/SenC-like protein [Arabidopsis thaliana] Length = 334 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 156 PVSWMSFFLLLCTGAGLVYYYDSVKRRHIE 245 PVSWMSFFLL TGAGLVYYYD+ K+RHIE Sbjct: 124 PVSWMSFFLLFATGAGLVYYYDTQKKRHIE 153 >ref|XP_002882593.1| electron transport SCO1/SenC family protein [Arabidopsis lyrata subsp. lyrata] gi|297328433|gb|EFH58852.1| electron transport SCO1/SenC family protein [Arabidopsis lyrata subsp. lyrata] Length = 334 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 156 PVSWMSFFLLLCTGAGLVYYYDSVKRRHIE 245 PVSWMSFFLL TGAGLVYYYD K+RHIE Sbjct: 124 PVSWMSFFLLFATGAGLVYYYDREKKRHIE 153