BLASTX nr result
ID: Scutellaria23_contig00032054
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00032054 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271238.2| PREDICTED: uncharacterized protein LOC100247... 77 1e-12 emb|CBI28388.3| unnamed protein product [Vitis vinifera] 77 1e-12 ref|XP_004156892.1| PREDICTED: protein GAMETE EXPRESSED 1-like [... 73 2e-11 ref|XP_004152367.1| PREDICTED: protein GAMETE EXPRESSED 1-like [... 72 5e-11 ref|XP_003597151.1| hypothetical protein MTR_2g093230 [Medicago ... 66 3e-09 >ref|XP_002271238.2| PREDICTED: uncharacterized protein LOC100247755 [Vitis vinifera] Length = 605 Score = 77.4 bits (189), Expect = 1e-12 Identities = 31/51 (60%), Positives = 43/51 (84%) Frame = -2 Query: 301 DSDVDWSTWIDYELPEDVGTSEDPNYILSEQVAENSVETSSVLKRYNLRNR 149 DSDVDWSTWID ++PEDV +DP++IL E++ ENS+ T+S+ ++YNLRNR Sbjct: 552 DSDVDWSTWIDTDMPEDVDIVKDPDFILQEEIGENSITTTSITRKYNLRNR 602 >emb|CBI28388.3| unnamed protein product [Vitis vinifera] Length = 547 Score = 77.4 bits (189), Expect = 1e-12 Identities = 31/51 (60%), Positives = 43/51 (84%) Frame = -2 Query: 301 DSDVDWSTWIDYELPEDVGTSEDPNYILSEQVAENSVETSSVLKRYNLRNR 149 DSDVDWSTWID ++PEDV +DP++IL E++ ENS+ T+S+ ++YNLRNR Sbjct: 494 DSDVDWSTWIDTDMPEDVDIVKDPDFILQEEIGENSITTTSITRKYNLRNR 544 >ref|XP_004156892.1| PREDICTED: protein GAMETE EXPRESSED 1-like [Cucumis sativus] Length = 588 Score = 73.2 bits (178), Expect = 2e-11 Identities = 33/54 (61%), Positives = 43/54 (79%) Frame = -2 Query: 307 DGDSDVDWSTWIDYELPEDVGTSEDPNYILSEQVAENSVETSSVLKRYNLRNRP 146 D DS+VDW++WID EL EDV EDP+++L EQV ENS+ T+S +RYNLR+RP Sbjct: 535 DSDSEVDWTSWIDTELSEDV---EDPDFVLPEQVGENSITTASTSRRYNLRHRP 585 >ref|XP_004152367.1| PREDICTED: protein GAMETE EXPRESSED 1-like [Cucumis sativus] Length = 585 Score = 72.0 bits (175), Expect = 5e-11 Identities = 32/54 (59%), Positives = 43/54 (79%) Frame = -2 Query: 307 DGDSDVDWSTWIDYELPEDVGTSEDPNYILSEQVAENSVETSSVLKRYNLRNRP 146 D DS+VDW++WID EL EDV EDP+++L E+V ENS+ T+S +RYNLR+RP Sbjct: 532 DSDSEVDWTSWIDTELSEDV---EDPDFVLPEEVGENSITTASTSRRYNLRHRP 582 >ref|XP_003597151.1| hypothetical protein MTR_2g093230 [Medicago truncatula] gi|355486199|gb|AES67402.1| hypothetical protein MTR_2g093230 [Medicago truncatula] Length = 696 Score = 65.9 bits (159), Expect = 3e-09 Identities = 28/51 (54%), Positives = 37/51 (72%) Frame = -2 Query: 295 DVDWSTWIDYELPEDVGTSEDPNYILSEQVAENSVETSSVLKRYNLRNRPN 143 DVDWS WID +LP+DV +DP++ + E+ AENS+ TS+ K YNLR R N Sbjct: 517 DVDWSQWIDTDLPDDVNCLDDPDFSIPEEFAENSITTSTTTKSYNLRPRDN 567