BLASTX nr result
ID: Scutellaria23_contig00032037
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00032037 (224 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_181541.1| protein kinase-like protein [Arabidopsis thalia... 147 9e-34 gb|AFW84681.1| putative protein kinase superfamily protein, part... 146 2e-33 ref|XP_002456586.1| hypothetical protein SORBIDRAFT_03g038890 [S... 146 2e-33 gb|ACN30766.1| unknown [Zea mays] 146 2e-33 ref|NP_001148168.1| ATP binding protein [Zea mays] gi|195616354|... 146 2e-33 >ref|NP_181541.1| protein kinase-like protein [Arabidopsis thaliana] gi|4587987|gb|AAD25928.1|AF085279_1 hypothetical Ser-Thr protein kinase [Arabidopsis thaliana] gi|14334460|gb|AAK59428.1| putative protein kinase [Arabidopsis thaliana] gi|17979101|gb|AAL47494.1| putative protein kinase [Arabidopsis thaliana] gi|330254690|gb|AEC09784.1| protein kinase-like protein [Arabidopsis thaliana] Length = 570 Score = 147 bits (371), Expect = 9e-34 Identities = 68/74 (91%), Positives = 71/74 (95%) Frame = -3 Query: 222 CLKIIKNDKDFFDQSLDEIKLLKFVNKHDPADEHHILRLYDYFYHQEHLFIVTELLKANL 43 CLKIIKNDKDFFDQSLDEIKLLK VNKHDPADEHHILRLYDYFYHQEHLFIV ELL+ANL Sbjct: 288 CLKIIKNDKDFFDQSLDEIKLLKHVNKHDPADEHHILRLYDYFYHQEHLFIVCELLRANL 347 Query: 42 YEFQKYNRESGAEP 1 YEFQK+N+ESG EP Sbjct: 348 YEFQKFNQESGGEP 361 >gb|AFW84681.1| putative protein kinase superfamily protein, partial [Zea mays] Length = 714 Score = 146 bits (369), Expect = 2e-33 Identities = 67/73 (91%), Positives = 71/73 (97%) Frame = -3 Query: 222 CLKIIKNDKDFFDQSLDEIKLLKFVNKHDPADEHHILRLYDYFYHQEHLFIVTELLKANL 43 CLKIIKNDKDFFDQSLDEIKLLKFVNK+DP DEHH+LRLYDYFYHQEHLFIVTELL+ANL Sbjct: 445 CLKIIKNDKDFFDQSLDEIKLLKFVNKYDPLDEHHVLRLYDYFYHQEHLFIVTELLRANL 504 Query: 42 YEFQKYNRESGAE 4 YEFQKYN+ESG E Sbjct: 505 YEFQKYNQESGGE 517 >ref|XP_002456586.1| hypothetical protein SORBIDRAFT_03g038890 [Sorghum bicolor] gi|241928561|gb|EES01706.1| hypothetical protein SORBIDRAFT_03g038890 [Sorghum bicolor] Length = 721 Score = 146 bits (369), Expect = 2e-33 Identities = 67/73 (91%), Positives = 71/73 (97%) Frame = -3 Query: 222 CLKIIKNDKDFFDQSLDEIKLLKFVNKHDPADEHHILRLYDYFYHQEHLFIVTELLKANL 43 CLKIIKNDKDFFDQSLDEIKLLKFVNK+DP DEHH+LRLYDYFYHQEHLFIVTELL+ANL Sbjct: 442 CLKIIKNDKDFFDQSLDEIKLLKFVNKYDPLDEHHVLRLYDYFYHQEHLFIVTELLRANL 501 Query: 42 YEFQKYNRESGAE 4 YEFQKYN+ESG E Sbjct: 502 YEFQKYNQESGGE 514 >gb|ACN30766.1| unknown [Zea mays] Length = 396 Score = 146 bits (369), Expect = 2e-33 Identities = 67/73 (91%), Positives = 71/73 (97%) Frame = -3 Query: 222 CLKIIKNDKDFFDQSLDEIKLLKFVNKHDPADEHHILRLYDYFYHQEHLFIVTELLKANL 43 CLKIIKNDKDFFDQSLDEIKLLKFVNK+DP DEHH+LRLYDYFYHQEHLFIVTELL+ANL Sbjct: 210 CLKIIKNDKDFFDQSLDEIKLLKFVNKYDPLDEHHVLRLYDYFYHQEHLFIVTELLRANL 269 Query: 42 YEFQKYNRESGAE 4 YEFQKYN+ESG E Sbjct: 270 YEFQKYNQESGGE 282 >ref|NP_001148168.1| ATP binding protein [Zea mays] gi|195616354|gb|ACG30007.1| ATP binding protein [Zea mays] gi|414879861|tpg|DAA56992.1| TPA: putative protein kinase superfamily protein [Zea mays] Length = 725 Score = 146 bits (369), Expect = 2e-33 Identities = 67/73 (91%), Positives = 71/73 (97%) Frame = -3 Query: 222 CLKIIKNDKDFFDQSLDEIKLLKFVNKHDPADEHHILRLYDYFYHQEHLFIVTELLKANL 43 CLKIIKNDKDFFDQSLDEIKLLKFVNK+DP DEHH+LRLYDYFYHQEHLFIVTELL+ANL Sbjct: 446 CLKIIKNDKDFFDQSLDEIKLLKFVNKYDPLDEHHVLRLYDYFYHQEHLFIVTELLRANL 505 Query: 42 YEFQKYNRESGAE 4 YEFQKYN+ESG E Sbjct: 506 YEFQKYNQESGGE 518