BLASTX nr result
ID: Scutellaria23_contig00031861
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00031861 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003516612.1| PREDICTED: probable indole-3-acetic acid-ami... 72 6e-11 ref|XP_002885948.1| GH3.1 [Arabidopsis lyrata subsp. lyrata] gi|... 71 1e-10 ref|NP_179101.1| putative indole-3-acetic acid-amido synthetase ... 71 1e-10 ref|XP_004141994.1| PREDICTED: probable indole-3-acetic acid-ami... 70 1e-10 gb|AFC36443.1| GH3-1 [Castanea sativa] 70 1e-10 >ref|XP_003516612.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1-like [Glycine max] Length = 631 Score = 71.6 bits (174), Expect = 6e-11 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -1 Query: 288 INQYKAPRCVSYTPIVELLDARVLSAHFSPAPPRWTPE 175 INQYK PRCVS+TPI+ELLD+RVLS HFSPA P WTPE Sbjct: 591 INQYKVPRCVSFTPIMELLDSRVLSFHFSPAAPHWTPE 628 >ref|XP_002885948.1| GH3.1 [Arabidopsis lyrata subsp. lyrata] gi|297331788|gb|EFH62207.1| GH3.1 [Arabidopsis lyrata subsp. lyrata] Length = 590 Score = 70.9 bits (172), Expect = 1e-10 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -1 Query: 288 INQYKAPRCVSYTPIVELLDARVLSAHFSPAPPRWTPE 175 INQYK PRCV++TPIVELLD+RV+SAHFSP+ P WTPE Sbjct: 549 INQYKVPRCVNFTPIVELLDSRVVSAHFSPSLPHWTPE 586 >ref|NP_179101.1| putative indole-3-acetic acid-amido synthetase GH3.1 [Arabidopsis thaliana] gi|62900130|sp|O82333.1|GH31_ARATH RecName: Full=Probable indole-3-acetic acid-amido synthetase GH3.1; AltName: Full=Auxin-responsive GH3-like protein 1; Short=AtGH3-1 gi|3650037|gb|AAC61292.1| putative auxin-regulated protein [Arabidopsis thaliana] gi|330251259|gb|AEC06353.1| putative indole-3-acetic acid-amido synthetase GH3.1 [Arabidopsis thaliana] Length = 590 Score = 70.9 bits (172), Expect = 1e-10 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -1 Query: 288 INQYKAPRCVSYTPIVELLDARVLSAHFSPAPPRWTPE 175 INQYK PRCV++TPIVELLD+RV+SAHFSP+ P WTPE Sbjct: 549 INQYKVPRCVNFTPIVELLDSRVVSAHFSPSLPHWTPE 586 >ref|XP_004141994.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1-like [Cucumis sativus] gi|449528118|ref|XP_004171053.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.1-like [Cucumis sativus] Length = 588 Score = 70.5 bits (171), Expect = 1e-10 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -1 Query: 288 INQYKAPRCVSYTPIVELLDARVLSAHFSPAPPRWTPE 175 INQYKAPRCV++TPI+ELLD+RV S HFSP+ P WTPE Sbjct: 548 INQYKAPRCVNFTPIIELLDSRVTSVHFSPSKPHWTPE 585 >gb|AFC36443.1| GH3-1 [Castanea sativa] Length = 603 Score = 70.5 bits (171), Expect = 1e-10 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -1 Query: 288 INQYKAPRCVSYTPIVELLDARVLSAHFSPAPPRWTPE 175 INQYKAPRCVS+TPI+ELLD+R++S HFSPA P WTP+ Sbjct: 563 INQYKAPRCVSFTPIMELLDSRIVSVHFSPALPHWTPQ 600