BLASTX nr result
ID: Scutellaria23_contig00031846
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00031846 (399 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275491.1| PREDICTED: pentatricopeptide repeat-containi... 67 1e-09 ref|XP_002320827.1| predicted protein [Populus trichocarpa] gi|2... 61 8e-08 ref|XP_004139715.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_003548443.1| PREDICTED: pentatricopeptide repeat-containi... 56 4e-06 >ref|XP_002275491.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial [Vitis vinifera] gi|297745328|emb|CBI40408.3| unnamed protein product [Vitis vinifera] Length = 765 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = +3 Query: 3 MTEQSCNPGFATMEILTQWLPAVGETEKLRKFVQGYDVSAS 125 MTE +CNP + TMEILT+WL AVGET KL+ FVQGY+VSAS Sbjct: 723 MTEHACNPDYITMEILTEWLSAVGETAKLKSFVQGYEVSAS 763 >ref|XP_002320827.1| predicted protein [Populus trichocarpa] gi|222861600|gb|EEE99142.1| predicted protein [Populus trichocarpa] Length = 775 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = +3 Query: 3 MTEQSCNPGFATMEILTQWLPAVGETEKLRKFVQGYDVSASTT*K 137 M E +CNP + TMEILT+WL AVGE E+L+KFV G +VS+ST K Sbjct: 726 MIEHACNPDYITMEILTEWLSAVGEIERLKKFVAGCEVSSSTAQK 770 >ref|XP_004139715.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Cucumis sativus] gi|449475521|ref|XP_004154479.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Cucumis sativus] Length = 660 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/47 (59%), Positives = 34/47 (72%), Gaps = 5/47 (10%) Frame = +3 Query: 3 MTEQSCNPGFATMEILTQWLPAVGETEKLRKFVQG-----YDVSAST 128 M EQ+CNP + TMEILT+WL AVGE KL+KF QG DVS+S+ Sbjct: 572 MVEQACNPDYITMEILTEWLSAVGEITKLKKFTQGCMNRTEDVSSSS 618 >ref|XP_003548443.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial-like [Glycine max] Length = 746 Score = 55.8 bits (133), Expect = 4e-06 Identities = 23/40 (57%), Positives = 31/40 (77%) Frame = +3 Query: 3 MTEQSCNPGFATMEILTQWLPAVGETEKLRKFVQGYDVSA 122 M E++C P + TME+LT+WL AVGE EKL+ FV+GY S+ Sbjct: 700 MVEEACRPDYITMEVLTEWLSAVGEIEKLKHFVEGYQDSS 739