BLASTX nr result
ID: Scutellaria23_contig00031829
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00031829 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265051.2| PREDICTED: uncharacterized protein LOC100245... 61 1e-07 gb|AAN05792.1| unknown [Gossypium hirsutum] 60 2e-07 emb|CAN62559.1| hypothetical protein VITISV_009207 [Vitis vinifera] 57 2e-06 ref|XP_002327656.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|XP_002529641.1| conserved hypothetical protein [Ricinus comm... 55 5e-06 >ref|XP_002265051.2| PREDICTED: uncharacterized protein LOC100245548 [Vitis vinifera] Length = 1169 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 178 EKMGCWYSRLDREEMVSRCKARKRYMKQFV 267 EKMGC YSR++REEMVSRCKARKRYMKQFV Sbjct: 529 EKMGCCYSRIEREEMVSRCKARKRYMKQFV 558 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +1 Query: 184 MGCWYSRLDREEMVSRCKARKRYMKQFV 267 MGC YSR++REEMVSRCKARKRYMKQFV Sbjct: 1 MGCCYSRIEREEMVSRCKARKRYMKQFV 28 >gb|AAN05792.1| unknown [Gossypium hirsutum] Length = 645 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +1 Query: 184 MGCWYSRLDREEMVSRCKARKRYMKQFV 267 MGCWYSR+DREE+VSRCKARKRYMKQ V Sbjct: 1 MGCWYSRIDREEIVSRCKARKRYMKQLV 28 >emb|CAN62559.1| hypothetical protein VITISV_009207 [Vitis vinifera] Length = 627 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +1 Query: 184 MGCWYSRLDREEMVSRCKARKRYMKQFV 267 MGC YSR++REEMVSRCKARKRYMKQFV Sbjct: 1 MGCCYSRIEREEMVSRCKARKRYMKQFV 28 >ref|XP_002327656.1| predicted protein [Populus trichocarpa] gi|222836741|gb|EEE75134.1| predicted protein [Populus trichocarpa] Length = 632 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +1 Query: 184 MGCWYSRLDREEMVSRCKARKRYMKQFV 267 MGC YSR++REEMVSRCKARKRYMKQ+V Sbjct: 1 MGCCYSRIEREEMVSRCKARKRYMKQYV 28 >ref|XP_002529641.1| conserved hypothetical protein [Ricinus communis] gi|223530867|gb|EEF32728.1| conserved hypothetical protein [Ricinus communis] Length = 637 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +1 Query: 184 MGCWYSRLDREEMVSRCKARKRYMKQFV 267 MGC YSRL+REEMVSRCKARKRYMKQ V Sbjct: 1 MGCCYSRLEREEMVSRCKARKRYMKQLV 28