BLASTX nr result
ID: Scutellaria23_contig00031815
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00031815 (617 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003592926.1| tRNA pseudouridine synthase A [Medicago trun... 89 8e-16 ref|NP_001242177.1| uncharacterized protein LOC100799818 [Glycin... 89 8e-16 gb|ABE79574.2| tRNA pseudouridine synthase [Medicago truncatula] 89 8e-16 ref|XP_003540148.1| PREDICTED: tRNA pseudouridine synthase A-lik... 88 1e-15 ref|XP_004161929.1| PREDICTED: tRNA pseudouridine synthase A-lik... 87 2e-15 >ref|XP_003592926.1| tRNA pseudouridine synthase A [Medicago truncatula] gi|355481974|gb|AES63177.1| tRNA pseudouridine synthase A [Medicago truncatula] Length = 375 Score = 88.6 bits (218), Expect = 8e-16 Identities = 42/54 (77%), Positives = 48/54 (88%) Frame = -1 Query: 617 QVRLLVGVLKSVGTGHLTISDVKRILEAKNVGLASPMAPACGLYLGQVKYDLPS 456 QVRLLVGVLK VGTG++T++DV+RIL AK V SPMAPACGLYLG+VKYDLPS Sbjct: 322 QVRLLVGVLKDVGTGNITVTDVERILNAKTVTATSPMAPACGLYLGEVKYDLPS 375 >ref|NP_001242177.1| uncharacterized protein LOC100799818 [Glycine max] gi|255637177|gb|ACU18919.1| unknown [Glycine max] Length = 370 Score = 88.6 bits (218), Expect = 8e-16 Identities = 43/54 (79%), Positives = 49/54 (90%) Frame = -1 Query: 617 QVRLLVGVLKSVGTGHLTISDVKRILEAKNVGLASPMAPACGLYLGQVKYDLPS 456 QVRLLVGVLK+VGTG+LTI DV+RIL A+ V ASPMAPACGLYLG+VKYDLP+ Sbjct: 316 QVRLLVGVLKAVGTGNLTIPDVERILNARTVTAASPMAPACGLYLGEVKYDLPT 369 >gb|ABE79574.2| tRNA pseudouridine synthase [Medicago truncatula] Length = 361 Score = 88.6 bits (218), Expect = 8e-16 Identities = 42/54 (77%), Positives = 48/54 (88%) Frame = -1 Query: 617 QVRLLVGVLKSVGTGHLTISDVKRILEAKNVGLASPMAPACGLYLGQVKYDLPS 456 QVRLLVGVLK VGTG++T++DV+RIL AK V SPMAPACGLYLG+VKYDLPS Sbjct: 308 QVRLLVGVLKDVGTGNITVTDVERILNAKTVTATSPMAPACGLYLGEVKYDLPS 361 >ref|XP_003540148.1| PREDICTED: tRNA pseudouridine synthase A-like [Glycine max] Length = 369 Score = 88.2 bits (217), Expect = 1e-15 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = -1 Query: 617 QVRLLVGVLKSVGTGHLTISDVKRILEAKNVGLASPMAPACGLYLGQVKYDLPS 456 QVRLLVGVLK+ GTG+LTI DV+RIL AK V ASPMAPACGLYLG+VKYDLP+ Sbjct: 315 QVRLLVGVLKAAGTGNLTIPDVERILNAKTVTAASPMAPACGLYLGEVKYDLPT 368 >ref|XP_004161929.1| PREDICTED: tRNA pseudouridine synthase A-like [Cucumis sativus] Length = 352 Score = 87.0 bits (214), Expect = 2e-15 Identities = 42/53 (79%), Positives = 46/53 (86%) Frame = -1 Query: 617 QVRLLVGVLKSVGTGHLTISDVKRILEAKNVGLASPMAPACGLYLGQVKYDLP 459 QVRL+VGVLK+VG+G LT+ DV RILEAKNV A PMAPACGLYLG VKYDLP Sbjct: 296 QVRLMVGVLKAVGSGDLTVGDVGRILEAKNVSSARPMAPACGLYLGHVKYDLP 348