BLASTX nr result
ID: Scutellaria23_contig00031803
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00031803 (371 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA05365.1| high mobility group protein [Solanum tuberosum] 64 2e-08 gb|AAF80615.1|AC069251_8 F2D10.18 [Arabidopsis thaliana] 62 4e-08 ref|NP_001031075.1| high mobility group B3 protein [Arabidopsis ... 62 4e-08 ref|XP_002890402.1| hypothetical protein ARALYDRAFT_472304 [Arab... 62 4e-08 ref|NP_001077570.1| high mobility group B3 protein [Arabidopsis ... 62 4e-08 >emb|CAA05365.1| high mobility group protein [Solanum tuberosum] Length = 141 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = +1 Query: 1 KAGGDKWKTMSDEEKAPYIAVAGTRKKEYECKMNAYNKKLA 123 KAGGDKWK +SDEEKAPY A A RK EY+ M+AYNKKLA Sbjct: 69 KAGGDKWKQLSDEEKAPYQAKAEKRKAEYQKNMDAYNKKLA 109 >gb|AAF80615.1|AC069251_8 F2D10.18 [Arabidopsis thaliana] Length = 662 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = +1 Query: 1 KAGGDKWKTMSDEEKAPYIAVAGTRKKEYECKMNAYNKKL 120 KAGG+KWK++SD EKAPY+A A RK EYE M AYNKKL Sbjct: 589 KAGGEKWKSLSDSEKAPYVAKADKRKVEYEKNMKAYNKKL 628 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = +1 Query: 1 KAGGDKWKTMSDEEKAPYIAVAGTRKKEYECKMNAYNKKL 120 KA GDKWK++SD EKAPY+A A RK EYE + AYNKKL Sbjct: 448 KAAGDKWKSLSDSEKAPYVAKAEKRKVEYEKNIKAYNKKL 487 >ref|NP_001031075.1| high mobility group B3 protein [Arabidopsis thaliana] gi|332191889|gb|AEE30010.1| high mobility group B3 protein [Arabidopsis thaliana] Length = 147 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = +1 Query: 1 KAGGDKWKTMSDEEKAPYIAVAGTRKKEYECKMNAYNKKL 120 KAGG+KWK++SD EKAPY+A A RK EYE M AYNKKL Sbjct: 68 KAGGEKWKSLSDSEKAPYVAKADKRKVEYEKNMKAYNKKL 107 >ref|XP_002890402.1| hypothetical protein ARALYDRAFT_472304 [Arabidopsis lyrata subsp. lyrata] gi|297336244|gb|EFH66661.1| hypothetical protein ARALYDRAFT_472304 [Arabidopsis lyrata subsp. lyrata] Length = 141 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = +1 Query: 1 KAGGDKWKTMSDEEKAPYIAVAGTRKKEYECKMNAYNKKL 120 KAGG+KWK++SD EKAPY+A A RK EYE M AYNKKL Sbjct: 70 KAGGEKWKSLSDSEKAPYVAKADKRKVEYEKNMKAYNKKL 109 >ref|NP_001077570.1| high mobility group B3 protein [Arabidopsis thaliana] gi|332191890|gb|AEE30011.1| high mobility group B3 protein [Arabidopsis thaliana] Length = 140 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = +1 Query: 1 KAGGDKWKTMSDEEKAPYIAVAGTRKKEYECKMNAYNKKL 120 KAGG+KWK++SD EKAPY+A A RK EYE M AYNKKL Sbjct: 68 KAGGEKWKSLSDSEKAPYVAKADKRKVEYEKNMKAYNKKL 107