BLASTX nr result
ID: Scutellaria23_contig00031722
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00031722 (301 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN70078.1| hypothetical protein VITISV_001036 [Vitis vinifera] 57 2e-06 >emb|CAN70078.1| hypothetical protein VITISV_001036 [Vitis vinifera] Length = 773 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/71 (33%), Positives = 42/71 (59%) Frame = +1 Query: 1 RCICIGLVNNDHFVQVILRDGHPLPPVLAKWRECHYPDAASWCIVCAKQLKLYKSIVGNN 180 R + IG +N++HFV++++ G P+PPV W + YP A W A + ++ +V N+ Sbjct: 701 RVLSIGFINDNHFVEILMTTGAPMPPVANSWSKSCYPCAEGWATPYAAYINMFHGLVSND 760 Query: 181 VNVVLDTINLE 213 V DT++L+ Sbjct: 761 V-ATQDTMHLD 770