BLASTX nr result
ID: Scutellaria23_contig00031523
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00031523 (347 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266688.1| PREDICTED: homeobox-leucine zipper protein P... 110 1e-22 ref|XP_002518520.1| homeobox protein, putative [Ricinus communis... 100 1e-19 ref|XP_002273837.2| PREDICTED: homeobox-leucine zipper protein H... 90 2e-16 emb|CBI28946.3| unnamed protein product [Vitis vinifera] 88 8e-16 emb|CAN66212.1| hypothetical protein VITISV_013736 [Vitis vinifera] 88 8e-16 >ref|XP_002266688.1| PREDICTED: homeobox-leucine zipper protein PROTODERMAL FACTOR 2 [Vitis vinifera] gi|302144076|emb|CBI23181.3| unnamed protein product [Vitis vinifera] Length = 726 Score = 110 bits (275), Expect = 1e-22 Identities = 48/75 (64%), Positives = 67/75 (89%) Frame = +2 Query: 122 MYQPNIYDNHHNLLDMGNRSPENELDHLRDDEYDQNNRSGAENMEAPSGDEEQDPNARPK 301 M+QPN++D+HH+LLDM +++PE+E+ +RD+E++ ++SG ENM+APSGD+ QDPN RPK Sbjct: 1 MFQPNMFDSHHHLLDMPHKTPESEMGKIRDEEFE--SKSGTENMDAPSGDD-QDPNQRPK 57 Query: 302 RKRYHRHTQHQIQEM 346 +KRYHRHTQHQIQEM Sbjct: 58 KKRYHRHTQHQIQEM 72 >ref|XP_002518520.1| homeobox protein, putative [Ricinus communis] gi|223542365|gb|EEF43907.1| homeobox protein, putative [Ricinus communis] Length = 727 Score = 100 bits (249), Expect = 1e-19 Identities = 46/75 (61%), Positives = 59/75 (78%) Frame = +2 Query: 122 MYQPNIYDNHHNLLDMGNRSPENELDHLRDDEYDQNNRSGAENMEAPSGDEEQDPNARPK 301 M+QP ++++HH + DM +S ENEL +L+DD+YD +SG E EAPSGD +QDPN RPK Sbjct: 1 MFQPALFESHH-MFDMTPKSSENELGNLKDDDYDHETKSGTETTEAPSGD-DQDPNQRPK 58 Query: 302 RKRYHRHTQHQIQEM 346 +KRYHRHTQ QIQEM Sbjct: 59 KKRYHRHTQRQIQEM 73 >ref|XP_002273837.2| PREDICTED: homeobox-leucine zipper protein HDG2 [Vitis vinifera] Length = 762 Score = 89.7 bits (221), Expect = 2e-16 Identities = 43/75 (57%), Positives = 57/75 (76%) Frame = +2 Query: 122 MYQPNIYDNHHNLLDMGNRSPENELDHLRDDEYDQNNRSGAENMEAPSGDEEQDPNARPK 301 M+QPN+ D + LDM + E+E+ LR+D++D ++SG+EN E SGD+ QDPN RPK Sbjct: 40 MFQPNMMDGQLHPLDMTQNTSESEIARLREDDFD--SKSGSENHEGASGDD-QDPNQRPK 96 Query: 302 RKRYHRHTQHQIQEM 346 +KRYHRHTQHQIQEM Sbjct: 97 KKRYHRHTQHQIQEM 111 >emb|CBI28946.3| unnamed protein product [Vitis vinifera] Length = 757 Score = 87.8 bits (216), Expect = 8e-16 Identities = 43/77 (55%), Positives = 57/77 (74%) Frame = +2 Query: 116 LKMYQPNIYDNHHNLLDMGNRSPENELDHLRDDEYDQNNRSGAENMEAPSGDEEQDPNAR 295 L + QPN+ D + LDM + E+E+ LR+D++D ++SG+EN E SGD+ QDPN R Sbjct: 31 LSLGQPNMMDGQLHPLDMTQNTSESEIARLREDDFD--SKSGSENHEGASGDD-QDPNQR 87 Query: 296 PKRKRYHRHTQHQIQEM 346 PK+KRYHRHTQHQIQEM Sbjct: 88 PKKKRYHRHTQHQIQEM 104 >emb|CAN66212.1| hypothetical protein VITISV_013736 [Vitis vinifera] Length = 754 Score = 87.8 bits (216), Expect = 8e-16 Identities = 43/77 (55%), Positives = 57/77 (74%) Frame = +2 Query: 116 LKMYQPNIYDNHHNLLDMGNRSPENELDHLRDDEYDQNNRSGAENMEAPSGDEEQDPNAR 295 L + QPN+ D + LDM + E+E+ LR+D++D ++SG+EN E SGD+ QDPN R Sbjct: 31 LSLGQPNMMDGQLHPLDMTQNTSESEIARLREDDFD--SKSGSENHEGASGDD-QDPNQR 87 Query: 296 PKRKRYHRHTQHQIQEM 346 PK+KRYHRHTQHQIQEM Sbjct: 88 PKKKRYHRHTQHQIQEM 104