BLASTX nr result
ID: Scutellaria23_contig00031252
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00031252 (263 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521903.1| serine/threonine-protein kinase bri1, putati... 75 6e-12 ref|XP_002312487.1| predicted protein [Populus trichocarpa] gi|2... 72 6e-11 ref|XP_003532682.1| PREDICTED: serine/threonine-protein kinase B... 71 1e-10 gb|ADQ43184.1| leucine-rich receptor kinase [Eutrema parvulum] 70 1e-10 gb|ACM89468.1| ATP-binding/protein serine/threonine kinase [Glyc... 70 1e-10 >ref|XP_002521903.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] gi|223538941|gb|EEF40539.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] Length = 1140 Score = 75.1 bits (183), Expect = 6e-12 Identities = 38/43 (88%), Positives = 40/43 (93%), Gaps = 1/43 (2%) Frame = -3 Query: 249 DEGHVE-VKEMVRYLEITLQCVDDFPSKRPNMLQVVAMLRDLL 124 DE VE VKEMVRYLEITLQCVDDFPSKRPNMLQVVAMLR+L+ Sbjct: 1087 DEAEVEEVKEMVRYLEITLQCVDDFPSKRPNMLQVVAMLRELM 1129 >ref|XP_002312487.1| predicted protein [Populus trichocarpa] gi|222852307|gb|EEE89854.1| predicted protein [Populus trichocarpa] Length = 1134 Score = 71.6 bits (174), Expect = 6e-11 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = -3 Query: 261 DEDEDEGHVEVKEMVRYLEITLQCVDDFPSKRPNMLQVVAMLRDLL 124 DE E E EVKEMVRYLEI+LQCVDDFPSKRP+MLQVVAMLR+L+ Sbjct: 1081 DEAEAE---EVKEMVRYLEISLQCVDDFPSKRPSMLQVVAMLRELM 1123 >ref|XP_003532682.1| PREDICTED: serine/threonine-protein kinase BRI1-like 2-like [Glycine max] Length = 1196 Score = 70.9 bits (172), Expect = 1e-10 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -3 Query: 261 DEDEDEGHVEVKEMVRYLEITLQCVDDFPSKRPNMLQVVAMLRDLL 124 DE E E EVKEM+RYLEIT+QCVDD PS+RPNMLQVVAMLR+L+ Sbjct: 1141 DEAEAEAK-EVKEMIRYLEITMQCVDDLPSRRPNMLQVVAMLRELM 1185 >gb|ADQ43184.1| leucine-rich receptor kinase [Eutrema parvulum] Length = 1141 Score = 70.5 bits (171), Expect = 1e-10 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -3 Query: 258 EDEDEGHVEVKEMVRYLEITLQCVDDFPSKRPNMLQVVAMLRDL 127 E E G V VKEM+RYLEI L+CVDDFPSKRPNMLQVVA LR+L Sbjct: 1088 EKESFGRVNVKEMLRYLEIALRCVDDFPSKRPNMLQVVASLREL 1131 >gb|ACM89468.1| ATP-binding/protein serine/threonine kinase [Glycine max] Length = 1086 Score = 70.5 bits (171), Expect = 1e-10 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -3 Query: 255 DEDEGHVEVKEMVRYLEITLQCVDDFPSKRPNMLQVVAMLRDLL 124 DE E EVKEM+RYLEITLQCVDD PS+RPNMLQVVAMLR+L+ Sbjct: 1033 DEAEAK-EVKEMIRYLEITLQCVDDLPSRRPNMLQVVAMLRELM 1075