BLASTX nr result
ID: Scutellaria23_contig00031066
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00031066 (474 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510040.1| transferase, transferring glycosyl groups, p... 83 2e-14 gb|AFZ78584.1| cellulose synthase-like protein [Populus tomentosa] 79 3e-13 ref|XP_002307301.1| predicted protein [Populus trichocarpa] gi|2... 79 3e-13 ref|XP_004143034.1| PREDICTED: probable xyloglucan glycosyltrans... 79 4e-13 gb|AFZ78583.1| cellulose synthase-like protein [Populus tomentosa] 78 7e-13 >ref|XP_002510040.1| transferase, transferring glycosyl groups, putative [Ricinus communis] gi|223550741|gb|EEF52227.1| transferase, transferring glycosyl groups, putative [Ricinus communis] Length = 696 Score = 83.2 bits (204), Expect = 2e-14 Identities = 40/54 (74%), Positives = 45/54 (83%) Frame = -2 Query: 164 WWAKEAHRGTPVVVKMENPNNWSMVELESPSDEDFIYPNDAVAKGGRNKNAKQL 3 WWAKE H+GTPVVVKMENP NWSMVELE PSDEDF+ D+ ++ RNKNAKQL Sbjct: 7 WWAKEGHKGTPVVVKMENP-NWSMVELEGPSDEDFLIAGDSPSR-RRNKNAKQL 58 >gb|AFZ78584.1| cellulose synthase-like protein [Populus tomentosa] Length = 701 Score = 79.3 bits (194), Expect = 3e-13 Identities = 39/57 (68%), Positives = 44/57 (77%), Gaps = 3/57 (5%) Frame = -2 Query: 164 WWAKEAHRGTPVVVKMENPNNWSMVELESPSDEDFIYPNDAVAKG---GRNKNAKQL 3 WWAK++HRGTPVVVKMENP NWSMVELE PS+EDF+ + G RNKNAKQL Sbjct: 7 WWAKDSHRGTPVVVKMENP-NWSMVELEGPSEEDFLITDSPSRLGRDKSRNKNAKQL 62 >ref|XP_002307301.1| predicted protein [Populus trichocarpa] gi|222856750|gb|EEE94297.1| predicted protein [Populus trichocarpa] Length = 701 Score = 79.3 bits (194), Expect = 3e-13 Identities = 39/57 (68%), Positives = 44/57 (77%), Gaps = 3/57 (5%) Frame = -2 Query: 164 WWAKEAHRGTPVVVKMENPNNWSMVELESPSDEDFIYPNDAVAKG---GRNKNAKQL 3 WWAK++HRGTPVVVKMENP NWSMVELE PS+EDF+ + G RNKNAKQL Sbjct: 7 WWAKDSHRGTPVVVKMENP-NWSMVELEGPSEEDFLITDSPSRLGRDKSRNKNAKQL 62 >ref|XP_004143034.1| PREDICTED: probable xyloglucan glycosyltransferase 12-like [Cucumis sativus] Length = 729 Score = 79.0 bits (193), Expect = 4e-13 Identities = 39/61 (63%), Positives = 45/61 (73%), Gaps = 4/61 (6%) Frame = -2 Query: 173 MSPWWAKEAHRGTPVVVKMENPNNWSMVELESPSDEDFIY----PNDAVAKGGRNKNAKQ 6 M+ WW +E+H+GTPVVVKMENP NWS+VE+ESPSDEDFI P GR KNAKQ Sbjct: 28 MASWWGRESHKGTPVVVKMENP-NWSIVEVESPSDEDFIIGAESPPGRARDKGRGKNAKQ 86 Query: 5 L 3 L Sbjct: 87 L 87 >gb|AFZ78583.1| cellulose synthase-like protein [Populus tomentosa] Length = 701 Score = 78.2 bits (191), Expect = 7e-13 Identities = 38/57 (66%), Positives = 44/57 (77%), Gaps = 3/57 (5%) Frame = -2 Query: 164 WWAKEAHRGTPVVVKMENPNNWSMVELESPSDEDFIYPNDAVAKG---GRNKNAKQL 3 WWAK++H+GTPVVVKMENP NWSMVELE PS+EDF+ + G RNKNAKQL Sbjct: 7 WWAKDSHKGTPVVVKMENP-NWSMVELEGPSEEDFLITDSPSRLGRDKSRNKNAKQL 62