BLASTX nr result
ID: Scutellaria23_contig00031009
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00031009 (228 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520416.1| leucine-rich repeat containing protein, puta... 64 2e-08 ref|XP_002515943.1| leucine-rich repeat containing protein, puta... 63 3e-08 ref|XP_002520413.1| hypothetical protein RCOM_1397400 [Ricinus c... 63 3e-08 ref|XP_002518080.1| leucine-rich repeat-containing protein, puta... 61 8e-08 emb|CAN71072.1| hypothetical protein VITISV_000086 [Vitis vinifera] 61 1e-07 >ref|XP_002520416.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223540401|gb|EEF41971.1| leucine-rich repeat containing protein, putative [Ricinus communis] Length = 661 Score = 63.5 bits (153), Expect = 2e-08 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 3/66 (4%) Frame = +2 Query: 2 ESLCSLHELQTLNVDNCFALSGLPKGIHRLINLKHLH---FENTRCIHHFPRGLDQLTAL 172 E+LC L LQTLN+D CF+L LP+G+ +LINL+HLH FE P+G+ +LT L Sbjct: 397 EALCELDNLQTLNMDGCFSLVKLPRGVEKLINLRHLHNGGFEGV-----LPKGISKLTCL 451 Query: 173 TTLTGF 190 +L F Sbjct: 452 RSLNRF 457 >ref|XP_002515943.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223544848|gb|EEF46363.1| leucine-rich repeat containing protein, putative [Ricinus communis] Length = 786 Score = 62.8 bits (151), Expect = 3e-08 Identities = 35/73 (47%), Positives = 47/73 (64%), Gaps = 3/73 (4%) Frame = +2 Query: 2 ESLCSLHELQTLNVDNCFALSGLPKGIHRLINLKHLH---FENTRCIHHFPRGLDQLTAL 172 E+LC L LQTLN+D CF+L LP+G+ +LINL+HLH FE P+G+ +LT L Sbjct: 426 EALCELCNLQTLNMDGCFSLVKLPRGLEKLINLRHLHNGGFEGV-----LPKGISKLTCL 480 Query: 173 TTLTGFHDSSGQS 211 +L F S GQ+ Sbjct: 481 RSLNRF--SIGQN 491 >ref|XP_002520413.1| hypothetical protein RCOM_1397400 [Ricinus communis] gi|223540398|gb|EEF41968.1| hypothetical protein RCOM_1397400 [Ricinus communis] Length = 387 Score = 62.8 bits (151), Expect = 3e-08 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 3/66 (4%) Frame = +2 Query: 2 ESLCSLHELQTLNVDNCFALSGLPKGIHRLINLKHLH---FENTRCIHHFPRGLDQLTAL 172 E+LC L LQTLN+D CF+L LP+G+ +LINL+HLH FE P+G+ +LT L Sbjct: 84 EALCELCNLQTLNMDGCFSLVKLPRGVEKLINLRHLHNGGFEGV-----LPKGISKLTCL 138 Query: 173 TTLTGF 190 +L F Sbjct: 139 RSLNRF 144 >ref|XP_002518080.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223542676|gb|EEF44213.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Length = 940 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/62 (45%), Positives = 43/62 (69%) Frame = +2 Query: 5 SLCSLHELQTLNVDNCFALSGLPKGIHRLINLKHLHFENTRCIHHFPRGLDQLTALTTLT 184 +L +L+ LQTLN+D C L LP G+ +L NL+HL+ T C++ FP+G+++L+ L LT Sbjct: 632 TLSNLYNLQTLNLDRCKRLQRLPGGLGKLKNLRHLNLRETDCLNIFPQGIERLSNLRMLT 691 Query: 185 GF 190 F Sbjct: 692 KF 693 >emb|CAN71072.1| hypothetical protein VITISV_000086 [Vitis vinifera] Length = 927 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/67 (43%), Positives = 45/67 (67%) Frame = +2 Query: 2 ESLCSLHELQTLNVDNCFALSGLPKGIHRLINLKHLHFENTRCIHHFPRGLDQLTALTTL 181 E++C L+ LQTLN++ C +L LP+ + +LINL+HL NT + P+G+ +L++L TL Sbjct: 623 ETICDLYNLQTLNIEGCSSLQKLPQAMGKLINLRHLENCNTGSLKGLPKGIGRLSSLQTL 682 Query: 182 TGFHDSS 202 F SS Sbjct: 683 DVFIVSS 689