BLASTX nr result
ID: Scutellaria23_contig00030854
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00030854 (303 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525227.1| pentatricopeptide repeat-containing protein,... 58 9e-07 >ref|XP_002525227.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535524|gb|EEF37193.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 420 Score = 57.8 bits (138), Expect = 9e-07 Identities = 39/94 (41%), Positives = 49/94 (52%), Gaps = 3/94 (3%) Frame = +2 Query: 29 KRGTQIFNCSKVIAFHSLKSFSLSTLGAVQRVETEDLDGFSGVLHEKDLLKKSPDGK--- 199 K+G C V A +T Q E++ L S ++ EKDLL+ S D Sbjct: 12 KQGWSFIRCLPVWASQ------FTTSNGSQLEESDALSSSSLIIEEKDLLRHSLDQSGTG 65 Query: 200 LVVLDLIDRGAMQPDARLYAELFKKCTDHGKLKE 301 L VLDLIDR +++PD LY LFKKCT KLKE Sbjct: 66 LHVLDLIDRASLEPDRTLYHILFKKCTLFNKLKE 99