BLASTX nr result
ID: Scutellaria23_contig00030849
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00030849 (210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007512427.1| conserved hypothetical protein [Agromonas ol... 142 2e-32 dbj|BAL79568.1| hypothetical protein S23_63860 [Bradyrhizobium s... 140 8e-32 ref|ZP_08244251.1| Hypothetical protein APO_2582 [Acetobacter po... 114 8e-24 ref|ZP_06097399.1| conserved hypothetical protein [Brucella sp. ... 113 2e-23 ref|ZP_05934035.1| conserved hypothetical protein [Brucella ceti... 113 2e-23 >ref|YP_007512427.1| conserved hypothetical protein [Agromonas oligotrophica S58] gi|459292957|ref|YP_007516114.1| conserved hypothetical protein [Agromonas oligotrophica S58] gi|456354395|dbj|BAM88840.1| conserved hypothetical protein [Agromonas oligotrophica S58] gi|456358082|dbj|BAM92527.1| conserved hypothetical protein [Agromonas oligotrophica S58] Length = 89 Score = 142 bits (359), Expect = 2e-32 Identities = 67/69 (97%), Positives = 69/69 (100%) Frame = -2 Query: 209 GGDDVKSSWPLRAGLHTCYNGGDSGQLRGDPSQISKSRLSSDWALQLEPMKLESLVIVDQ 30 GGDDVKSSWPLRAGLHTCYNGGDSG+LRG+PSQISKSRLSSDWALQLEPMKLESLVIVDQ Sbjct: 7 GGDDVKSSWPLRAGLHTCYNGGDSGKLRGNPSQISKSRLSSDWALQLEPMKLESLVIVDQ 66 Query: 29 HATVNTFPG 3 HATVNTFPG Sbjct: 67 HATVNTFPG 75 >dbj|BAL79568.1| hypothetical protein S23_63860 [Bradyrhizobium sp. S23321] Length = 89 Score = 140 bits (354), Expect = 8e-32 Identities = 66/69 (95%), Positives = 68/69 (98%) Frame = -2 Query: 209 GGDDVKSSWPLRAGLHTCYNGGDSGQLRGDPSQISKSRLSSDWALQLEPMKLESLVIVDQ 30 GGDDVKSSWPLRAGLHTCYNGGD+G LRG+PSQISKSRLSSDWALQLEPMKLESLVIVDQ Sbjct: 7 GGDDVKSSWPLRAGLHTCYNGGDNGTLRGNPSQISKSRLSSDWALQLEPMKLESLVIVDQ 66 Query: 29 HATVNTFPG 3 HATVNTFPG Sbjct: 67 HATVNTFPG 75 >ref|ZP_08244251.1| Hypothetical protein APO_2582 [Acetobacter pomorum DM001] gi|326695170|gb|EGE46866.1| Hypothetical protein APO_2582 [Acetobacter pomorum DM001] Length = 105 Score = 114 bits (285), Expect = 8e-24 Identities = 56/69 (81%), Positives = 58/69 (84%) Frame = -2 Query: 209 GGDDVKSSWPLRAGLHTCYNGGDSGQLRGDPSQISKSRLSSDWALQLEPMKLESLVIVDQ 30 GGDDVKSSWPL GLHTCYNGGDSG+L GD ISKSRLSSD LQLE MK+ESLVI DQ Sbjct: 20 GGDDVKSSWPLCPGLHTCYNGGDSGKLGGDTMLISKSRLSSDCTLQLECMKVESLVIADQ 79 Query: 29 HATVNTFPG 3 HA VNTFPG Sbjct: 80 HAAVNTFPG 88 >ref|ZP_06097399.1| conserved hypothetical protein [Brucella sp. 83/13] gi|264663256|gb|EEZ33517.1| conserved hypothetical protein [Brucella sp. 83/13] Length = 122 Score = 113 bits (282), Expect = 2e-23 Identities = 56/69 (81%), Positives = 57/69 (82%) Frame = -2 Query: 209 GGDDVKSSWPLRAGLHTCYNGGDSGQLRGDPSQISKSRLSSDWALQLEPMKLESLVIVDQ 30 GGDDVKSSWPLRAGLHTCYNGGDSGQ + ISKS LSSD LQLE MKLESLVI DQ Sbjct: 15 GGDDVKSSWPLRAGLHTCYNGGDSGQRARECELISKSHLSSDCTLQLECMKLESLVIADQ 74 Query: 29 HATVNTFPG 3 HA VNTFPG Sbjct: 75 HAAVNTFPG 83 >ref|ZP_05934035.1| conserved hypothetical protein [Brucella ceti M13/05/1] gi|261316118|ref|ZP_05955315.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] gi|261322643|ref|ZP_05961840.1| conserved hypothetical protein [Brucella ceti M644/93/1] gi|261757300|ref|ZP_06001009.1| conserved hypothetical protein [Brucella sp. F5/99] gi|260924843|gb|EEX91411.1| conserved hypothetical protein [Brucella ceti M13/05/1] gi|261295333|gb|EEX98829.1| conserved hypothetical protein [Brucella ceti M644/93/1] gi|261305144|gb|EEY08641.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] gi|261737284|gb|EEY25280.1| conserved hypothetical protein [Brucella sp. F5/99] Length = 116 Score = 113 bits (282), Expect = 2e-23 Identities = 56/69 (81%), Positives = 57/69 (82%) Frame = -2 Query: 209 GGDDVKSSWPLRAGLHTCYNGGDSGQLRGDPSQISKSRLSSDWALQLEPMKLESLVIVDQ 30 GGDDVKSSWPLRAGLHTCYNGGDSGQ + ISKS LSSD LQLE MKLESLVI DQ Sbjct: 9 GGDDVKSSWPLRAGLHTCYNGGDSGQRARECELISKSHLSSDCTLQLECMKLESLVIADQ 68 Query: 29 HATVNTFPG 3 HA VNTFPG Sbjct: 69 HAAVNTFPG 77