BLASTX nr result
ID: Scutellaria23_contig00030739
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00030739 (219 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_05822976.1| cell wall-associated hydrolase [Brucella abor... 91 1e-16 gb|ADI18733.1| hypothetical protein [uncultured Rhizobiales bact... 90 2e-16 ref|ZP_12939398.1| hypothetical protein HMPREF9956_2590 [Staphyl... 89 4e-16 ref|ZP_06283573.1| conserved domain protein [Staphylococcus epid... 89 4e-16 ref|ZP_06284621.1| conserved domain protein [Staphylococcus epid... 89 4e-16 >ref|ZP_05822976.1| cell wall-associated hydrolase [Brucella abortus NCTC 8038] gi|260565853|ref|ZP_05836335.1| cell wall-associated hydrolase [Brucella melitensis bv. 1 str. 16M] gi|261219758|ref|ZP_05934039.1| cell wall-associated hydrolase [Brucella ceti M13/05/1] gi|261313976|ref|ZP_05953173.1| cell wall-associated hydrolase [Brucella pinnipedialis M163/99/10] gi|261316146|ref|ZP_05955343.1| cell wall-associated hydrolase [Brucella pinnipedialis B2/94] gi|261322647|ref|ZP_05961844.1| cell wall-associated hydrolase [Brucella ceti M644/93/1] gi|265984660|ref|ZP_06097395.1| cell wall-associated hydrolase [Brucella sp. 83/13] gi|265996870|ref|ZP_06109427.1| cell wall-associated hydrolase [Brucella ceti M490/95/1] gi|260095405|gb|EEW79284.1| cell wall-associated hydrolase [Brucella abortus NCTC 8038] gi|260151029|gb|EEW86125.1| cell wall-associated hydrolase [Brucella melitensis bv. 1 str. 16M] gi|260924847|gb|EEX91415.1| cell wall-associated hydrolase [Brucella ceti M13/05/1] gi|261295337|gb|EEX98833.1| cell wall-associated hydrolase [Brucella ceti M644/93/1] gi|261295369|gb|EEX98865.1| cell wall-associated hydrolase [Brucella pinnipedialis B2/94] gi|261303002|gb|EEY06499.1| cell wall-associated hydrolase [Brucella pinnipedialis M163/99/10] gi|262551237|gb|EEZ07328.1| cell wall-associated hydrolase [Brucella ceti M490/95/1] gi|264663252|gb|EEZ33513.1| cell wall-associated hydrolase [Brucella sp. 83/13] Length = 152 Score = 90.5 bits (223), Expect = 1e-16 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = -3 Query: 160 MLSAVIPSVHSYAALPLARQQLHQRYVHPGPLVLGANPLNIPTPTADRDRTVS 2 M SAVIPSV+SY A+ LA QQ+HQRYVHPGPLVLG +P+NIPTPTADRDRTVS Sbjct: 1 MPSAVIPSVYSYPAMRLAPQQVHQRYVHPGPLVLGTDPVNIPTPTADRDRTVS 53 >gb|ADI18733.1| hypothetical protein [uncultured Rhizobiales bacterium HF4000_32B18] Length = 125 Score = 90.1 bits (222), Expect = 2e-16 Identities = 40/53 (75%), Positives = 45/53 (84%) Frame = -1 Query: 219 LVVFHGSQGNARFEVGFPLRCFQRLSRPYIAMLHCRWRDNSSTRGTFTPVLSY 61 +VV++GSQG RF+VGFPLRCFQRLSRPY+A L C WR N STRGT TPVLSY Sbjct: 73 VVVYNGSQGRTRFQVGFPLRCFQRLSRPYVATLQCGWRHNRSTRGTSTPVLSY 125 >ref|ZP_12939398.1| hypothetical protein HMPREF9956_2590 [Staphylococcus epidermidis 14.1.R1.SE] gi|365232177|gb|EHM73188.1| hypothetical protein HMPREF9956_2590 [Staphylococcus epidermidis 14.1.R1.SE] Length = 105 Score = 89.0 bits (219), Expect = 4e-16 Identities = 41/53 (77%), Positives = 45/53 (84%) Frame = -3 Query: 160 MLSAVIPSVHSYAALPLARQQLHQRYVHPGPLVLGANPLNIPTPTADRDRTVS 2 MLSA+IPS+HSY A+PLARQ +HQRYVHPGPLVL PL PTPT DRDRTVS Sbjct: 1 MLSALIPSIHSYPAMPLARQLVHQRYVHPGPLVLRTAPLKFPTPTTDRDRTVS 53 >ref|ZP_06283573.1| conserved domain protein [Staphylococcus epidermidis SK135] gi|281296523|gb|EFA89036.1| conserved domain protein [Staphylococcus epidermidis SK135] Length = 54 Score = 89.0 bits (219), Expect = 4e-16 Identities = 41/53 (77%), Positives = 45/53 (84%) Frame = -3 Query: 160 MLSAVIPSVHSYAALPLARQQLHQRYVHPGPLVLGANPLNIPTPTADRDRTVS 2 MLSA+IPS+HSY A+PLARQ +HQRYVHPGPLVL PL PTPT DRDRTVS Sbjct: 1 MLSALIPSIHSYPAMPLARQLVHQRYVHPGPLVLRTAPLKFPTPTTDRDRTVS 53 >ref|ZP_06284621.1| conserved domain protein [Staphylococcus epidermidis SK135] gi|281294779|gb|EFA87306.1| conserved domain protein [Staphylococcus epidermidis SK135] Length = 55 Score = 89.0 bits (219), Expect = 4e-16 Identities = 41/53 (77%), Positives = 45/53 (84%) Frame = -3 Query: 160 MLSAVIPSVHSYAALPLARQQLHQRYVHPGPLVLGANPLNIPTPTADRDRTVS 2 MLSA+IPS+HSY A+PLARQ +HQRYVHPGPLVL PL PTPT DRDRTVS Sbjct: 1 MLSALIPSIHSYPAMPLARQLVHQRYVHPGPLVLRTAPLKFPTPTTDRDRTVS 53