BLASTX nr result
ID: Scutellaria23_contig00030706
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00030706 (344 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002321643.1| predicted protein [Populus trichocarpa] gi|2... 68 7e-10 ref|XP_002511294.1| cytochrome P450, putative [Ricinus communis]... 66 3e-09 ref|XP_003529310.1| PREDICTED: cytochrome P450 71A4-like [Glycin... 64 1e-08 dbj|BAD06417.1| cytochrome P450 [Asparagus officinalis] 64 2e-08 gb|ADO16183.1| cytochrome P450 mono-oxygenase [Artemisia annua] 63 2e-08 >ref|XP_002321643.1| predicted protein [Populus trichocarpa] gi|222868639|gb|EEF05770.1| predicted protein [Populus trichocarpa] Length = 497 Score = 68.2 bits (165), Expect = 7e-10 Identities = 30/57 (52%), Positives = 43/57 (75%) Frame = +1 Query: 1 GIGFGTNNIEHTLANLLHKFDWELPDGAKSEELDVAERPGMTLQKKIPLVLVASHNS 171 G F ++ IE TLA+LLHKF+W LP GAK E+LD+ E PG+ + +K PLV++A+ +S Sbjct: 440 GTTFASSVIEITLASLLHKFNWALPGGAKPEDLDITEAPGLAIHRKFPLVVIATPHS 496 >ref|XP_002511294.1| cytochrome P450, putative [Ricinus communis] gi|223550409|gb|EEF51896.1| cytochrome P450, putative [Ricinus communis] Length = 508 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/54 (55%), Positives = 39/54 (72%) Frame = +1 Query: 1 GIGFGTNNIEHTLANLLHKFDWELPDGAKSEELDVAERPGMTLQKKIPLVLVAS 162 GI F T+ E LANLLHKFDW LPDG K ++LD+ E G+T+ +K PL+ VA+ Sbjct: 451 GIQFATSLEELALANLLHKFDWALPDGVKEDDLDMTESVGLTVHRKFPLLAVAT 504 >ref|XP_003529310.1| PREDICTED: cytochrome P450 71A4-like [Glycine max] Length = 512 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/54 (53%), Positives = 39/54 (72%) Frame = +1 Query: 1 GIGFGTNNIEHTLANLLHKFDWELPDGAKSEELDVAERPGMTLQKKIPLVLVAS 162 GI F TN IE LANL+H+FDW LP GA E+LD++E G+ + +K PL+ VA+ Sbjct: 454 GITFATNIIEVVLANLVHQFDWSLPGGAAGEDLDMSETAGLAVHRKSPLLAVAT 507 >dbj|BAD06417.1| cytochrome P450 [Asparagus officinalis] Length = 498 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/53 (52%), Positives = 40/53 (75%) Frame = +1 Query: 1 GIGFGTNNIEHTLANLLHKFDWELPDGAKSEELDVAERPGMTLQKKIPLVLVA 159 G+ F N+E LANL+++FDWELPDG KSE+LD+ + PG+T +++ L LVA Sbjct: 438 GMHFAAANLELALANLMYRFDWELPDGMKSEDLDMGDSPGLTTRRRQNLHLVA 490 >gb|ADO16183.1| cytochrome P450 mono-oxygenase [Artemisia annua] Length = 491 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/58 (50%), Positives = 38/58 (65%) Frame = +1 Query: 1 GIGFGTNNIEHTLANLLHKFDWELPDGAKSEELDVAERPGMTLQKKIPLVLVASHNSN 174 GI G N++E LANL++ FDW LPDG K E++D PG+T+ K L L+A NSN Sbjct: 431 GISMGVNSVELFLANLIYSFDWGLPDGTKIEDIDSGVLPGLTMTNKKDLCLLAHFNSN 488