BLASTX nr result
ID: Scutellaria23_contig00030372
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00030372 (421 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAE71190.1| aminoacyl-tRNA synthetase [Trifolium pratense] 55 6e-06 >dbj|BAE71190.1| aminoacyl-tRNA synthetase [Trifolium pratense] Length = 745 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +3 Query: 324 QCSKLVTPLVGELEQSQLPRWNIRSMWQLASI 419 QCSK+VTPLV +SQLPRWN+RSMW+LAS+ Sbjct: 97 QCSKIVTPLVEPPSESQLPRWNLRSMWELASV 128