BLASTX nr result
ID: Scutellaria23_contig00029999
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00029999 (248 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004173690.1| PREDICTED: uncharacterized protein LOC101226... 84 2e-14 ref|XP_004136157.1| PREDICTED: uncharacterized protein LOC101220... 84 2e-14 ref|XP_003591428.1| Lipase [Medicago truncatula] gi|355480476|gb... 80 1e-13 ref|XP_003518863.1| PREDICTED: uncharacterized protein LOC100807... 78 8e-13 gb|AAG10634.1|AC022521_12 Hypothetical protein [Arabidopsis thal... 76 2e-12 >ref|XP_004173690.1| PREDICTED: uncharacterized protein LOC101226119, partial [Cucumis sativus] Length = 621 Score = 83.6 bits (205), Expect = 2e-14 Identities = 39/53 (73%), Positives = 49/53 (92%) Frame = +3 Query: 90 SFSKLLRKVPLAESRLYAQLSYLGCLAYSIPQIKPGNLLRYHRLQFVTSSLEK 248 SFS+LLR+V LAE+RLYAQ+SYLGCLAYSI +IKP NLLRY+ L+++TSS+EK Sbjct: 183 SFSRLLRRVSLAEARLYAQMSYLGCLAYSISEIKPKNLLRYYGLRYITSSIEK 235 >ref|XP_004136157.1| PREDICTED: uncharacterized protein LOC101220023 [Cucumis sativus] Length = 714 Score = 83.6 bits (205), Expect = 2e-14 Identities = 39/53 (73%), Positives = 49/53 (92%) Frame = +3 Query: 90 SFSKLLRKVPLAESRLYAQLSYLGCLAYSIPQIKPGNLLRYHRLQFVTSSLEK 248 SFS+LLR+V LAE+RLYAQ+SYLGCLAYSI +IKP NLLRY+ L+++TSS+EK Sbjct: 172 SFSRLLRRVSLAEARLYAQMSYLGCLAYSISEIKPKNLLRYYGLRYITSSIEK 224 >ref|XP_003591428.1| Lipase [Medicago truncatula] gi|355480476|gb|AES61679.1| Lipase [Medicago truncatula] Length = 680 Score = 80.5 bits (197), Expect = 1e-13 Identities = 39/53 (73%), Positives = 48/53 (90%) Frame = +3 Query: 90 SFSKLLRKVPLAESRLYAQLSYLGCLAYSIPQIKPGNLLRYHRLQFVTSSLEK 248 SFSK+LR+V LAE+RLYAQ+S+LG LAYSIP IKPG LL+++ L+FVTSSLEK Sbjct: 161 SFSKMLRRVSLAEARLYAQMSHLGSLAYSIPNIKPGKLLKHYGLRFVTSSLEK 213 >ref|XP_003518863.1| PREDICTED: uncharacterized protein LOC100807834 [Glycine max] Length = 704 Score = 77.8 bits (190), Expect = 8e-13 Identities = 37/53 (69%), Positives = 48/53 (90%) Frame = +3 Query: 90 SFSKLLRKVPLAESRLYAQLSYLGCLAYSIPQIKPGNLLRYHRLQFVTSSLEK 248 SFS++LR+V LAESRLYAQ+S+LG LAY IP+IKPG LL+++ L+FVTSS+EK Sbjct: 154 SFSRMLRRVSLAESRLYAQMSHLGNLAYDIPRIKPGKLLKHYGLRFVTSSIEK 206 >gb|AAG10634.1|AC022521_12 Hypothetical protein [Arabidopsis thaliana] Length = 693 Score = 76.3 bits (186), Expect = 2e-12 Identities = 39/53 (73%), Positives = 45/53 (84%) Frame = +3 Query: 90 SFSKLLRKVPLAESRLYAQLSYLGCLAYSIPQIKPGNLLRYHRLQFVTSSLEK 248 SFSKLLR+V L ES+LYAQLSYLG LAYSI +IKP NL +Y+ L+FVTSS EK Sbjct: 176 SFSKLLRRVTLPESKLYAQLSYLGNLAYSISKIKPANLSKYYGLRFVTSSAEK 228