BLASTX nr result
ID: Scutellaria23_contig00029925
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00029925 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307356.1| predicted protein [Populus trichocarpa] gi|2... 69 4e-10 ref|XP_002512343.1| ring finger protein, putative [Ricinus commu... 66 3e-09 gb|AFW73525.1| putative RING zinc finger domain superfamily prot... 65 6e-09 gb|AFW73524.1| putative RING zinc finger domain superfamily prot... 65 6e-09 ref|XP_003534006.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-... 65 6e-09 >ref|XP_002307356.1| predicted protein [Populus trichocarpa] gi|222856805|gb|EEE94352.1| predicted protein [Populus trichocarpa] Length = 436 Score = 68.9 bits (167), Expect = 4e-10 Identities = 28/53 (52%), Positives = 37/53 (69%) Frame = -1 Query: 267 PKCNHIFHPECVGAWLKFHITCPVCRANLDPLAGHEPVRATQPWHTNDMESEL 109 PKC+H+FHP+C+ AWL H+TCPVCRANL P G P P H +D +++L Sbjct: 160 PKCSHVFHPDCIDAWLTSHVTCPVCRANLVPKPGDLPF---NPVHVDDPKNDL 209 >ref|XP_002512343.1| ring finger protein, putative [Ricinus communis] gi|223548304|gb|EEF49795.1| ring finger protein, putative [Ricinus communis] Length = 380 Score = 66.2 bits (160), Expect = 3e-09 Identities = 26/54 (48%), Positives = 38/54 (70%), Gaps = 2/54 (3%) Frame = -1 Query: 267 PKCNHIFHPECVGAWLKFHITCPVCRANLDPLAGHEPVRATQ--PWHTNDMESE 112 PKC+H+FHP+C+ AWL H TCPVCR+NL P P + T+ P ++D+E++ Sbjct: 140 PKCDHVFHPDCIDAWLASHTTCPVCRSNLTPQPVDPPTQTTESLPDSSSDLEAQ 193 >gb|AFW73525.1| putative RING zinc finger domain superfamily protein [Zea mays] Length = 419 Score = 65.1 bits (157), Expect = 6e-09 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -1 Query: 267 PKCNHIFHPECVGAWLKFHITCPVCRANLDP 175 PKC+H FHPEC+G WL H+TCPVCR NLDP Sbjct: 143 PKCSHAFHPECIGEWLASHVTCPVCRCNLDP 173 >gb|AFW73524.1| putative RING zinc finger domain superfamily protein [Zea mays] Length = 502 Score = 65.1 bits (157), Expect = 6e-09 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -1 Query: 267 PKCNHIFHPECVGAWLKFHITCPVCRANLDP 175 PKC+H FHPEC+G WL H+TCPVCR NLDP Sbjct: 143 PKCSHAFHPECIGEWLASHVTCPVCRCNLDP 173 >ref|XP_003534006.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-like [Glycine max] Length = 362 Score = 65.1 bits (157), Expect = 6e-09 Identities = 26/48 (54%), Positives = 32/48 (66%) Frame = -1 Query: 267 PKCNHIFHPECVGAWLKFHITCPVCRANLDPLAGHEPVRATQPWHTND 124 PKCNH+FHP C+ +WL H+TCPVCRANL + H V T P H + Sbjct: 144 PKCNHVFHPHCIDSWLACHVTCPVCRANLSQESSH--VSITVPPHNEE 189