BLASTX nr result
ID: Scutellaria23_contig00029888
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00029888 (409 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABR13322.1| putative class III peroxidase [Prunus dulcis] 80 2e-13 ref|XP_003624729.1| Peroxidase [Medicago truncatula] gi|12436045... 76 3e-12 ref|XP_002525672.1| Peroxidase 44 precursor, putative [Ricinus c... 72 5e-11 ref|XP_003520954.1| PREDICTED: peroxidase 44-like [Glycine max] 69 3e-10 ref|XP_003624726.1| Peroxidase [Medicago truncatula] gi|35549974... 69 5e-10 >gb|ABR13322.1| putative class III peroxidase [Prunus dulcis] Length = 72 Score = 80.1 bits (196), Expect = 2e-13 Identities = 38/56 (67%), Positives = 45/56 (80%) Frame = -2 Query: 408 ELALDRSTAPIVRSFAANGAAFHQSFANAMIKMSKIQVLVGKAGEIRKNCRVFNPR 241 ELA DRST IV FA+NG F +SFA A++KM+ +QVLVG AGEIRKNCRVFNP+ Sbjct: 17 ELASDRSTTGIVSGFASNGVRFSRSFATAIVKMASLQVLVGNAGEIRKNCRVFNPK 72 >ref|XP_003624729.1| Peroxidase [Medicago truncatula] gi|124360457|gb|ABN08467.1| Haem peroxidase, plant/fungal/bacterial [Medicago truncatula] gi|355499744|gb|AES80947.1| Peroxidase [Medicago truncatula] Length = 315 Score = 75.9 bits (185), Expect = 3e-12 Identities = 37/57 (64%), Positives = 45/57 (78%) Frame = -2 Query: 408 ELALDRSTAPIVRSFAANGAAFHQSFANAMIKMSKIQVLVGKAGEIRKNCRVFNPRS 238 +LALD+ST+ V +FA+NG F +SFA AMIKM K+ VLVG GEIRKNCRVFN R+ Sbjct: 259 QLALDKSTSTFVSNFASNGDKFVKSFATAMIKMGKVGVLVGNEGEIRKNCRVFNKRN 315 >ref|XP_002525672.1| Peroxidase 44 precursor, putative [Ricinus communis] gi|223534972|gb|EEF36655.1| Peroxidase 44 precursor, putative [Ricinus communis] Length = 324 Score = 72.0 bits (175), Expect = 5e-11 Identities = 34/62 (54%), Positives = 43/62 (69%) Frame = -2 Query: 408 ELALDRSTAPIVRSFAANGAAFHQSFANAMIKMSKIQVLVGKAGEIRKNCRVFNPRSTTN 229 EL++D S+A V SFA NG F QSF NAM+K+ ++VLVG AGE+R NCRVFN + Sbjct: 259 ELSVDGSSAGFVSSFARNGIGFKQSFGNAMVKLGTVEVLVGNAGEVRTNCRVFNAQKKPM 318 Query: 228 PP 223 P Sbjct: 319 NP 320 >ref|XP_003520954.1| PREDICTED: peroxidase 44-like [Glycine max] Length = 314 Score = 69.3 bits (168), Expect = 3e-10 Identities = 34/57 (59%), Positives = 42/57 (73%) Frame = -2 Query: 408 ELALDRSTAPIVRSFAANGAAFHQSFANAMIKMSKIQVLVGKAGEIRKNCRVFNPRS 238 +LALD + +V FA N AAF +SFA+AM+KM I+VLVG GEIR+NCRVFN S Sbjct: 258 QLALDTLSKGLVTVFAGNNAAFQRSFADAMVKMGNIKVLVGNEGEIRRNCRVFNSAS 314 >ref|XP_003624726.1| Peroxidase [Medicago truncatula] gi|355499741|gb|AES80944.1| Peroxidase [Medicago truncatula] Length = 366 Score = 68.6 bits (166), Expect = 5e-10 Identities = 32/54 (59%), Positives = 41/54 (75%) Frame = -2 Query: 408 ELALDRSTAPIVRSFAANGAAFHQSFANAMIKMSKIQVLVGKAGEIRKNCRVFN 247 +L LD+ST+ V +FA+NG F +FA AMIKM KI +L+G GE+RKNCRVFN Sbjct: 310 KLTLDKSTSLFVSNFASNGEKFVNNFATAMIKMGKIGLLIGNEGEVRKNCRVFN 363