BLASTX nr result
ID: Scutellaria23_contig00029882
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00029882 (261 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521308.1| copper ion binding protein, putative [Ricinu... 66 3e-09 ref|XP_002321953.1| predicted protein [Populus trichocarpa] gi|2... 63 2e-08 ref|NP_974830.1| heavy metal transport/detoxification domain-con... 63 3e-08 ref|NP_001154734.1| heavy metal transport/detoxification domain-... 63 3e-08 gb|AAM65923.1| unknown [Arabidopsis thaliana] 63 3e-08 >ref|XP_002521308.1| copper ion binding protein, putative [Ricinus communis] gi|223539493|gb|EEF41082.1| copper ion binding protein, putative [Ricinus communis] Length = 316 Score = 65.9 bits (159), Expect = 3e-09 Identities = 28/39 (71%), Positives = 36/39 (92%) Frame = -3 Query: 187 VEEQSMHRMMYNLYQPVYMIERIPPPQLFSDENPNACTV 71 ++E++M RMMY YQP+Y+IERIPPPQLFSDENPNAC++ Sbjct: 278 IDEENMKRMMY-YYQPLYVIERIPPPQLFSDENPNACSI 315 >ref|XP_002321953.1| predicted protein [Populus trichocarpa] gi|222868949|gb|EEF06080.1| predicted protein [Populus trichocarpa] Length = 314 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = -3 Query: 187 VEEQSMHRMMYNLYQPVYMIERIPPPQLFSDENPNACTV 71 ++E++M RMM+ QP+Y+IERIPPPQLFSDENPNAC + Sbjct: 275 IDEENMKRMMHYYDQPLYVIERIPPPQLFSDENPNACCI 313 >ref|NP_974830.1| heavy metal transport/detoxification domain-containing protein [Arabidopsis thaliana] gi|332005945|gb|AED93328.1| heavy metal transport/detoxification domain-containing protein [Arabidopsis thaliana] Length = 318 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 190 IVEEQSMHRMMYNLYQPVYMIERIPPPQLFSDENPNACTV 71 + +E+ M RMMY YQP Y+IERIPPPQLFSDENPNAC + Sbjct: 279 MAQEEGMKRMMY-YYQPSYVIERIPPPQLFSDENPNACCI 317 >ref|NP_001154734.1| heavy metal transport/detoxification domain-containing protein [Arabidopsis thaliana] gi|332005946|gb|AED93329.1| heavy metal transport/detoxification domain-containing protein [Arabidopsis thaliana] Length = 316 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 190 IVEEQSMHRMMYNLYQPVYMIERIPPPQLFSDENPNACTV 71 + +E+ M RMMY YQP Y+IERIPPPQLFSDENPNAC + Sbjct: 277 MAQEEGMKRMMY-YYQPSYVIERIPPPQLFSDENPNACCI 315 >gb|AAM65923.1| unknown [Arabidopsis thaliana] Length = 320 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -3 Query: 190 IVEEQSMHRMMYNLYQPVYMIERIPPPQLFSDENPNACTV 71 + +E+ M RMMY YQP Y+IERIPPPQLFSDENPNAC + Sbjct: 281 MAQEEGMKRMMY-YYQPSYVIERIPPPQLFSDENPNACCI 319