BLASTX nr result
ID: Scutellaria23_contig00029833
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00029833 (243 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003524539.1| PREDICTED: zinc finger CCCH domain-containin... 97 2e-18 ref|XP_003550830.1| PREDICTED: zinc finger CCCH domain-containin... 96 2e-18 ref|XP_002281877.1| PREDICTED: zinc finger CCCH domain-containin... 96 2e-18 ref|XP_002883175.1| zinc finger (CCCH-type) family protein [Arab... 95 5e-18 dbj|BAJ34607.1| unnamed protein product [Thellungiella halophila] 94 9e-18 >ref|XP_003524539.1| PREDICTED: zinc finger CCCH domain-containing protein 39-like [Glycine max] Length = 345 Score = 96.7 bits (239), Expect = 2e-18 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 2/59 (3%) Frame = -1 Query: 189 NPPGNKGTSHIFYKTRICAKFMEGTCRNGEHCTFAHGAEDLREPPPNWQELI--REKER 19 +P NKGTSHIF+KTRICAKF G CRNGE+C FAHG ED+R+PPPNWQEL+ R +ER Sbjct: 72 HPALNKGTSHIFFKTRICAKFRAGACRNGENCNFAHGLEDMRQPPPNWQELVGLRNEER 130 >ref|XP_003550830.1| PREDICTED: zinc finger CCCH domain-containing protein 39-like [Glycine max] Length = 347 Score = 96.3 bits (238), Expect = 2e-18 Identities = 43/64 (67%), Positives = 51/64 (79%), Gaps = 2/64 (3%) Frame = -1 Query: 189 NPPGNKGTSHIFYKTRICAKFMEGTCRNGEHCTFAHGAEDLREPPPNWQELI--REKERG 16 +P NKGTSHIF+KTRICAKF G CRNGE+C FAHG ED+R+PPPNWQEL+ R +ER Sbjct: 72 HPAVNKGTSHIFFKTRICAKFRVGACRNGENCNFAHGLEDMRQPPPNWQELVGLRGEERP 131 Query: 15 SGSG 4 +G Sbjct: 132 PMAG 135 >ref|XP_002281877.1| PREDICTED: zinc finger CCCH domain-containing protein 39-like [Vitis vinifera] Length = 349 Score = 96.3 bits (238), Expect = 2e-18 Identities = 42/63 (66%), Positives = 52/63 (82%), Gaps = 4/63 (6%) Frame = -1 Query: 189 NPPGNKGTSHIFYKTRICAKFMEGTCRNGEHCTFAHGAEDLREPPPNWQELI----REKE 22 N P ++GTS+IF+KTRICAKF G CRNGE+C FAHG ED+R+PPPNWQEL+ RE+E Sbjct: 75 NAPTSRGTSNIFFKTRICAKFKLGQCRNGENCNFAHGMEDMRQPPPNWQELVNVGGREEE 134 Query: 21 RGS 13 RG+ Sbjct: 135 RGT 137 >ref|XP_002883175.1| zinc finger (CCCH-type) family protein [Arabidopsis lyrata subsp. lyrata] gi|297329015|gb|EFH59434.1| zinc finger (CCCH-type) family protein [Arabidopsis lyrata subsp. lyrata] Length = 389 Score = 95.1 bits (235), Expect = 5e-18 Identities = 43/63 (68%), Positives = 49/63 (77%), Gaps = 7/63 (11%) Frame = -1 Query: 186 PPGNKGTSHIFYKTRICAKFMEGTCRNGEHCTFAHGAEDLREPPPNWQELI-------RE 28 PP NKGT++IFYKTR+CAKF GTCRNGE C FAHG EDLR+PP NWQE++ RE Sbjct: 96 PPVNKGTANIFYKTRMCAKFRAGTCRNGELCNFAHGIEDLRQPPSNWQEIVGPPPGQDRE 155 Query: 27 KER 19 KER Sbjct: 156 KER 158 >dbj|BAJ34607.1| unnamed protein product [Thellungiella halophila] Length = 391 Score = 94.4 bits (233), Expect = 9e-18 Identities = 42/62 (67%), Positives = 49/62 (79%), Gaps = 6/62 (9%) Frame = -1 Query: 186 PPGNKGTSHIFYKTRICAKFMEGTCRNGEHCTFAHGAEDLREPPPNWQELI------REK 25 PP NKGT++IFYKTR+CAKF GTCRNGE C FAHG EDLR+PP NWQE++ RE+ Sbjct: 99 PPVNKGTANIFYKTRMCAKFKAGTCRNGELCNFAHGIEDLRQPPSNWQEIVGPPVQDRER 158 Query: 24 ER 19 ER Sbjct: 159 ER 160