BLASTX nr result
ID: Scutellaria23_contig00029663
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00029663 (260 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273322.1| PREDICTED: nucleolar protein 14-like [Vitis ... 57 2e-06 ref|XP_004165503.1| PREDICTED: nucleolar protein 14-like [Cucumi... 55 8e-06 ref|XP_004144162.1| PREDICTED: nucleolar protein 14-like [Cucumi... 55 8e-06 >ref|XP_002273322.1| PREDICTED: nucleolar protein 14-like [Vitis vinifera] Length = 973 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -1 Query: 107 NSEAKKSKAPKENPFESIWSRRKFDVLGKKRKDEE 3 NS A K KAP+ NPFE+IWSR KFD+LGKKRK E+ Sbjct: 28 NSVAMKLKAPQSNPFETIWSRTKFDILGKKRKGEQ 62 >ref|XP_004165503.1| PREDICTED: nucleolar protein 14-like [Cucumis sativus] Length = 914 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -1 Query: 92 KSKAPKENPFESIWSRRKFDVLGKKRKDEE 3 K APK NPFESIWS RKFDVLGKKRK EE Sbjct: 32 KVSAPKANPFESIWSHRKFDVLGKKRKGEE 61 >ref|XP_004144162.1| PREDICTED: nucleolar protein 14-like [Cucumis sativus] Length = 913 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -1 Query: 92 KSKAPKENPFESIWSRRKFDVLGKKRKDEE 3 K APK NPFESIWS RKFDVLGKKRK EE Sbjct: 31 KVSAPKANPFESIWSHRKFDVLGKKRKGEE 60