BLASTX nr result
ID: Scutellaria23_contig00029600
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00029600 (352 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003525361.1| PREDICTED: calcium-dependent protein kinase ... 80 2e-13 ref|XP_002526062.1| calcium-dependent protein kinase, putative [... 79 5e-13 ref|XP_003622837.1| Calcium dependent protein kinase [Medicago t... 77 1e-12 emb|CAG27840.1| calcium-dependent protein kinase 17 [Nicotiana p... 77 1e-12 ref|XP_002871516.1| calcium-dependent protein kinase 17 [Arabido... 76 3e-12 >ref|XP_003525361.1| PREDICTED: calcium-dependent protein kinase 3-like isoform 2 [Glycine max] Length = 532 Score = 79.7 bits (195), Expect = 2e-13 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = -3 Query: 275 YAIAPEVLKRRYGPEADIWSIGVMLYILLSGVPPFWAGMFIAFEEQCC 132 Y +APEVL+R YGPEADIWS GV+LYILLSGVPPFWAG+F F C Sbjct: 231 YYVAPEVLRRSYGPEADIWSAGVILYILLSGVPPFWAGIFTLFVNLLC 278 >ref|XP_002526062.1| calcium-dependent protein kinase, putative [Ricinus communis] gi|223534643|gb|EEF36339.1| calcium-dependent protein kinase, putative [Ricinus communis] Length = 536 Score = 78.6 bits (192), Expect = 5e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 275 YAIAPEVLKRRYGPEADIWSIGVMLYILLSGVPPFWA 165 Y IAPEVLKRRYGPEADIWS+GVMLYILLSGVPPFWA Sbjct: 247 YYIAPEVLKRRYGPEADIWSVGVMLYILLSGVPPFWA 283 >ref|XP_003622837.1| Calcium dependent protein kinase [Medicago truncatula] gi|355497852|gb|AES79055.1| Calcium dependent protein kinase [Medicago truncatula] Length = 534 Score = 77.4 bits (189), Expect = 1e-12 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = -3 Query: 275 YAIAPEVLKRRYGPEADIWSIGVMLYILLSGVPPFWA 165 Y IAPEVLKRRYGPE DIWSIGVMLYILLSGVPPFWA Sbjct: 244 YYIAPEVLKRRYGPEVDIWSIGVMLYILLSGVPPFWA 280 >emb|CAG27840.1| calcium-dependent protein kinase 17 [Nicotiana plumbaginifolia] Length = 534 Score = 77.0 bits (188), Expect = 1e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -3 Query: 275 YAIAPEVLKRRYGPEADIWSIGVMLYILLSGVPPFWA 165 Y IAPEVLKRRYGPE DIWS+GVMLYILLSGVPPFWA Sbjct: 243 YYIAPEVLKRRYGPEVDIWSVGVMLYILLSGVPPFWA 279 >ref|XP_002871516.1| calcium-dependent protein kinase 17 [Arabidopsis lyrata subsp. lyrata] gi|297317353|gb|EFH47775.1| calcium-dependent protein kinase 17 [Arabidopsis lyrata subsp. lyrata] Length = 530 Score = 75.9 bits (185), Expect = 3e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -3 Query: 275 YAIAPEVLKRRYGPEADIWSIGVMLYILLSGVPPFWA 165 Y IAPEVLKR+YGPEADIWSIGVMLYILL GVPPFWA Sbjct: 241 YYIAPEVLKRKYGPEADIWSIGVMLYILLCGVPPFWA 277