BLASTX nr result
ID: Scutellaria23_contig00029596
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00029596 (258 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271825.2| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 >ref|XP_002271825.2| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Vitis vinifera] Length = 702 Score = 57.0 bits (136), Expect = 2e-06 Identities = 32/91 (35%), Positives = 46/91 (50%), Gaps = 7/91 (7%) Frame = -1 Query: 252 PPSVASEPPSTTQTRVHLHKLNRRQEVRTHKQQQNQSLPQ-------IHQTILPFLNAEL 94 P + +PP Q H N ++ Q S PQ H T L L+ ++ Sbjct: 6 PQTTTPQPPPPPQ-----HDFNVPRKPTNLSFQSPNSTPQSMHLSTAAHHTHLSLLDKQI 60 Query: 93 NSTVYASVLDSCNSVKFGQQVHAHLLKNGFH 1 +S+ YAS+L+SC ++ G+QVHAH LK GFH Sbjct: 61 DSSTYASLLESCRTLNLGKQVHAHTLKTGFH 91