BLASTX nr result
ID: Scutellaria23_contig00029351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00029351 (547 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002314757.1| predicted protein [Populus trichocarpa] gi|2... 87 1e-15 ref|XP_003589750.1| Type II inositol-1,4,5-trisphosphate 5-phosp... 85 6e-15 ref|XP_003589749.1| Type II inositol-1,4,5-trisphosphate 5-phosp... 85 6e-15 ref|XP_002521915.1| type I inositol polyphosphate 5-phosphatase,... 85 8e-15 ref|XP_003522201.1| PREDICTED: type I inositol-1,4,5-trisphospha... 82 4e-14 >ref|XP_002314757.1| predicted protein [Populus trichocarpa] gi|222863797|gb|EEF00928.1| predicted protein [Populus trichocarpa] Length = 278 Score = 87.4 bits (215), Expect = 1e-15 Identities = 41/59 (69%), Positives = 46/59 (77%), Gaps = 2/59 (3%) Frame = -3 Query: 545 FRLHETGFCFVCSHLASGGKEGDERHRNTDVEHILGRTLFP--AEQHLPRKILDHEYVH 375 F+LHET FCFVCSHLASGG+EGDE+HR +DV I RT FP LPRKILDHEYV+ Sbjct: 220 FQLHETSFCFVCSHLASGGREGDEKHRKSDVAEIFSRTSFPRGPSFDLPRKILDHEYVN 278 >ref|XP_003589750.1| Type II inositol-1,4,5-trisphosphate 5-phosphatase [Medicago truncatula] gi|355478798|gb|AES60001.1| Type II inositol-1,4,5-trisphosphate 5-phosphatase [Medicago truncatula] Length = 448 Score = 85.1 bits (209), Expect = 6e-15 Identities = 40/58 (68%), Positives = 46/58 (79%), Gaps = 2/58 (3%) Frame = -3 Query: 545 FRLHETGFCFVCSHLASGGKEGDERHRNTDVEHILGRTLFPAEQ--HLPRKILDHEYV 378 F LHET FCFVCSHLASGGKEGDE+HRN++V I RT FP +LPRKILDH++V Sbjct: 224 FLLHETSFCFVCSHLASGGKEGDEKHRNSNVAEIFSRTSFPKGTILNLPRKILDHDHV 281 >ref|XP_003589749.1| Type II inositol-1,4,5-trisphosphate 5-phosphatase [Medicago truncatula] gi|355478797|gb|AES60000.1| Type II inositol-1,4,5-trisphosphate 5-phosphatase [Medicago truncatula] Length = 452 Score = 85.1 bits (209), Expect = 6e-15 Identities = 40/58 (68%), Positives = 46/58 (79%), Gaps = 2/58 (3%) Frame = -3 Query: 545 FRLHETGFCFVCSHLASGGKEGDERHRNTDVEHILGRTLFPAEQ--HLPRKILDHEYV 378 F LHET FCFVCSHLASGGKEGDE+HRN++V I RT FP +LPRKILDH++V Sbjct: 228 FLLHETSFCFVCSHLASGGKEGDEKHRNSNVAEIFSRTSFPKGTILNLPRKILDHDHV 285 >ref|XP_002521915.1| type I inositol polyphosphate 5-phosphatase, putative [Ricinus communis] gi|223538953|gb|EEF40551.1| type I inositol polyphosphate 5-phosphatase, putative [Ricinus communis] Length = 426 Score = 84.7 bits (208), Expect = 8e-15 Identities = 40/58 (68%), Positives = 46/58 (79%), Gaps = 2/58 (3%) Frame = -3 Query: 545 FRLHETGFCFVCSHLASGGKEGDERHRNTDVEHILGRTLFP--AEQHLPRKILDHEYV 378 F+LHET FCF+CSHLASGG+EGDE+HRN+DV IL RT FP LPRKILDH+ V Sbjct: 225 FQLHETSFCFICSHLASGGREGDEKHRNSDVAEILLRTSFPRGPSLDLPRKILDHDRV 282 >ref|XP_003522201.1| PREDICTED: type I inositol-1,4,5-trisphosphate 5-phosphatase 2-like [Glycine max] Length = 663 Score = 82.4 bits (202), Expect = 4e-14 Identities = 39/59 (66%), Positives = 44/59 (74%), Gaps = 3/59 (5%) Frame = -3 Query: 545 FRLHETGFCFVCSHLASGGKEGDERHRNTDVEHILGRTLFPAE---QHLPRKILDHEYV 378 F LHET FCFVC HLASGG+EGDE+HRN++V I RT FP LPRKILDHE+V Sbjct: 208 FVLHETSFCFVCGHLASGGREGDEKHRNSNVAEIFSRTSFPRRGPMLDLPRKILDHEHV 266