BLASTX nr result
ID: Scutellaria23_contig00029339
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00029339 (239 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN74695.1| hypothetical protein VITISV_024648 [Vitis vinifera] 55 8e-06 >emb|CAN74695.1| hypothetical protein VITISV_024648 [Vitis vinifera] Length = 1424 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/35 (65%), Positives = 28/35 (80%) Frame = +2 Query: 5 HVINRLLTPVLGNKSPFEILFHSSPNYANFKVFGC 109 ++INRL TPVL NKSP E+LFH P+Y+ KVFGC Sbjct: 699 YLINRLPTPVLKNKSPLEVLFHQKPSYSXLKVFGC 733