BLASTX nr result
ID: Scutellaria23_contig00029298
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00029298 (303 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510290.1| conserved hypothetical protein [Ricinus comm... 74 1e-11 ref|XP_002515369.1| DNA binding protein, putative [Ricinus commu... 71 8e-11 ref|XP_002515368.1| conserved hypothetical protein [Ricinus comm... 67 2e-09 ref|XP_002327099.1| predicted protein [Populus trichocarpa] gi|2... 65 4e-09 ref|XP_003631680.1| PREDICTED: B3 domain-containing protein Os11... 65 7e-09 >ref|XP_002510290.1| conserved hypothetical protein [Ricinus communis] gi|223550991|gb|EEF52477.1| conserved hypothetical protein [Ricinus communis] Length = 285 Score = 73.9 bits (180), Expect = 1e-11 Identities = 27/80 (33%), Positives = 52/80 (65%) Frame = +3 Query: 3 PSDFKKHLMNERTDRVTLRTTIGSWDVKVLQDEEGGMRFVQGWKEFIKHHSLGKAEFLLF 182 P F + + E +DR ++++ W +KV + +G + F +GW++F+KHH L +F++F Sbjct: 32 PVAFCRQIKGEGSDRAVVKSSDREWHIKVGKCCDGSLYFEEGWEDFVKHHGLNLGDFVVF 91 Query: 183 KYNGDMSFDVVIFNTDGCAR 242 +YNGD+ FD ++F++ C + Sbjct: 92 EYNGDLVFDAIVFDSSACEK 111 >ref|XP_002515369.1| DNA binding protein, putative [Ricinus communis] gi|223545313|gb|EEF46818.1| DNA binding protein, putative [Ricinus communis] Length = 368 Score = 71.2 bits (173), Expect = 8e-11 Identities = 35/83 (42%), Positives = 47/83 (56%), Gaps = 1/83 (1%) Frame = +3 Query: 3 PSDFKKHLMNERTDRVTLRTTIGS-WDVKVLQDEEGGMRFVQGWKEFIKHHSLGKAEFLL 179 P F KHL R + LR+T G W VK+ G RF GWK+F K+H L +FL+ Sbjct: 23 PVSFFKHLKGNRREIAVLRSTAGKLWHVKI-----NGRRFEDGWKDFAKYHDLHIGDFLV 77 Query: 180 FKYNGDMSFDVVIFNTDGCARNY 248 F++ GDM F V++F+ C R Y Sbjct: 78 FRHEGDMVFYVMVFDPSACEREY 100 >ref|XP_002515368.1| conserved hypothetical protein [Ricinus communis] gi|223545312|gb|EEF46817.1| conserved hypothetical protein [Ricinus communis] Length = 559 Score = 66.6 bits (161), Expect = 2e-09 Identities = 32/83 (38%), Positives = 46/83 (55%), Gaps = 1/83 (1%) Frame = +3 Query: 3 PSDFKKHLMNERTDRVTLRTTIGS-WDVKVLQDEEGGMRFVQGWKEFIKHHSLGKAEFLL 179 P F K+L + L + G W +K+ G RF GWKEF +HH L +FL+ Sbjct: 24 PVSFFKYLKGQECKNAVLSSCPGKLWPIKI-----NGRRFEDGWKEFTRHHDLHVGDFLV 78 Query: 180 FKYNGDMSFDVVIFNTDGCARNY 248 F++ GDM F V +F++ CAR+Y Sbjct: 79 FRHEGDMLFHVKVFDSSTCARDY 101 >ref|XP_002327099.1| predicted protein [Populus trichocarpa] gi|222835414|gb|EEE73849.1| predicted protein [Populus trichocarpa] Length = 314 Score = 65.5 bits (158), Expect = 4e-09 Identities = 32/75 (42%), Positives = 47/75 (62%), Gaps = 1/75 (1%) Frame = +3 Query: 3 PSDFKKHLMNERTDRVTLRTTIGS-WDVKVLQDEEGGMRFVQGWKEFIKHHSLGKAEFLL 179 P F HL N+ + VTL+ GS W V++ D+ M F GW++F+K H L + + L+ Sbjct: 39 PEKFSNHLKNKLLENVTLKGPSGSTWQVELTTDDNT-MFFKHGWEDFVKDHFLEEKDLLI 97 Query: 180 FKYNGDMSFDVVIFN 224 FKYNG+ FDV+IF+ Sbjct: 98 FKYNGESYFDVLIFD 112 >ref|XP_003631680.1| PREDICTED: B3 domain-containing protein Os11g0197600-like [Vitis vinifera] Length = 273 Score = 64.7 bits (156), Expect = 7e-09 Identities = 35/82 (42%), Positives = 49/82 (59%), Gaps = 1/82 (1%) Frame = +3 Query: 3 PSDFKKHLMNERTDRVTLRTTIGS-WDVKVLQDEEGGMRFVQGWKEFIKHHSLGKAEFLL 179 P F KHL + +DR TL + G W V V ++ +G GWKEF++ ++LG EFL+ Sbjct: 49 PPAFIKHLAGDISDRATLTCSSGGHWGVTVWKNPDGTY-LEDGWKEFMRENNLGDDEFLV 107 Query: 180 FKYNGDMSFDVVIFNTDGCARN 245 F Y+GDM F V IF +G R+ Sbjct: 108 FIYDGDMRFHVKIFEKNGVKRS 129