BLASTX nr result
ID: Scutellaria23_contig00029256
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00029256 (289 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAZ39645.1| cytochrome P450 monooxygenase [Petunia x hybrida] 57 1e-06 gb|AAL54887.1|AF092916_1 cytochrome P450-dependent fatty acid hy... 57 1e-06 gb|AAL54884.1|AF092913_1 cytochrome P450-dependent fatty acid hy... 57 1e-06 emb|CBI17962.3| unnamed protein product [Vitis vinifera] 57 2e-06 ref|XP_002282477.1| PREDICTED: cytochrome P450 94A1-like [Vitis ... 57 2e-06 >gb|AAZ39645.1| cytochrome P450 monooxygenase [Petunia x hybrida] Length = 509 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 100 LLQRFGFDNICKIVFDFDPTYLLPSLPAADFAV 2 +LQRF FDNICKI F +DP YLLPSLP A+FAV Sbjct: 185 ILQRFAFDNICKIAFGYDPGYLLPSLPQAEFAV 217 >gb|AAL54887.1|AF092916_1 cytochrome P450-dependent fatty acid hydroxylase [Nicotiana tabacum] Length = 511 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 100 LLQRFGFDNICKIVFDFDPTYLLPSLPAADFAV 2 +LQRF FDNICKI F +DP YLLPSLP A+FAV Sbjct: 187 ILQRFAFDNICKIAFGYDPGYLLPSLPEAEFAV 219 >gb|AAL54884.1|AF092913_1 cytochrome P450-dependent fatty acid hydroxylase [Nicotiana tabacum] Length = 510 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 100 LLQRFGFDNICKIVFDFDPTYLLPSLPAADFAV 2 +LQRF FDNICKI F +DP YLLPSLP A+FAV Sbjct: 186 ILQRFAFDNICKIAFGYDPGYLLPSLPEAEFAV 218 >emb|CBI17962.3| unnamed protein product [Vitis vinifera] Length = 563 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 100 LLQRFGFDNICKIVFDFDPTYLLPSLPAADFAV 2 +LQRF FDNICKI F +DP YLLPSLP A FAV Sbjct: 237 ILQRFAFDNICKIAFGYDPAYLLPSLPQAKFAV 269 >ref|XP_002282477.1| PREDICTED: cytochrome P450 94A1-like [Vitis vinifera] Length = 506 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -1 Query: 100 LLQRFGFDNICKIVFDFDPTYLLPSLPAADFAV 2 +LQRF FDNICKI F +DP YLLPSLP A FAV Sbjct: 180 ILQRFAFDNICKIAFGYDPAYLLPSLPQAKFAV 212