BLASTX nr result
ID: Scutellaria23_contig00029171
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00029171 (440 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003542880.1| PREDICTED: uncharacterized protein LOC100527... 55 6e-06 >ref|XP_003542880.1| PREDICTED: uncharacterized protein LOC100527685 [Glycine max] Length = 68 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +3 Query: 165 KMNALRSMVVVIGASAFGYLTLQLGFKPYLEK 260 KMNA+RS +VV+GA AFGYL++Q+GFKPYLEK Sbjct: 10 KMNAIRSGIVVLGALAFGYLSIQIGFKPYLEK 41