BLASTX nr result
ID: Scutellaria23_contig00029083
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00029083 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF64710.1| putative transposase [Ipomoea tricolor] 61 4e-08 >dbj|BAF64710.1| putative transposase [Ipomoea tricolor] Length = 517 Score = 61.2 bits (147), Expect(2) = 4e-08 Identities = 26/77 (33%), Positives = 51/77 (66%) Frame = -2 Query: 242 LYHSKL*GTRIHATVKREYMNRFTDLLTEGSLYAVRHFIVLHNRMKYKTTTNKYMLMFFN 63 ++H K GT +H + +E++ +++ +L G +Y++R+F+V+ N YKT+ +KYML F+ Sbjct: 45 IFHDKE-GTVLHVNIPKEFVEKYSAMLKIGQVYSIRNFLVISNFYTYKTSPHKYMLKFYY 103 Query: 62 ETRAVEIHDEDFPTFLY 12 +T E+ D FP+ ++ Sbjct: 104 KTVVRELKDIVFPSHMF 120 Score = 20.8 bits (42), Expect(2) = 4e-08 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = -1 Query: 321 ECVFHDSE 298 EC+FHD E Sbjct: 43 ECIFHDKE 50